DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and p4ha1b

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_999856.1 Gene:p4ha1b ZFINID:ZDB-GENE-030131-4089 Length:536 Species:Danio rerio

Alignment Length:519 Identity:148/520 (28%)
Similarity:237/520 (46%) Gaps:81/520 (16%)


  Fly    32 YAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSRENMEMKSDYESYLGNPLNSF 96
            :..||.::..||..|.:||.:||.|:|..:.:...::.....:....:....|.|.:||:|:|:|
Zfish    21 FFTSTGQMTDLLYAEKDLVTSLKEYIKQEENRLEQVKEWADKLDSLTITATQDPEGFLGHPVNAF 85

  Fly    97 RLIHRLHTSWRKWYQYAIKVENNALGHIENARLMRKMLPTSSDLQQACRGIHDLMSFYDLKPEEL 161
            :|:.||::.|.......:|...|  |.|.|..:.|:..||..|...|.:.:..|...|.|....:
Zfish    86 KLMKRLNSEWSDLENLVLKDTTN--GFISNLTVQRQYFPTDEDQTGAAKALLRLQDTYQLSANAI 148

  Fly   162 AAGNLAGYSQPGTGLTAYDCLALGEFSVQKREDDLAEAWYNLSLIRF----ENKFDK-------- 214
            ::|:|.|.... :.:|..||..||:.:....:....|.|...:|.:.    |:..||        
Zfish   149 SSGDLPGVVHK-SRMTVEDCYELGKIAYSDADYYHTELWMAQALSQLDEGEESPIDKVTVMDYLS 212

  Fly   215 YRVHKAW----GLLLAKNKQLTDAFYHFENKPEGII------------ASNEVIHFKEE------ 257
            |.:::..    .|.|.|.....|..:|..|   |.:            |.||.   |||      
Zfish   213 YAIYQQGELDRALELTKRMLKLDPNHHRAN---GNLKYFEFQLEKQRKAENEK---KEEDQKRVL 271

  Fly   258 ----------------------LSTKQNCAVVVQKPSRLHCRY-NTTTTPFTRIAPLKMEELGLD 299
                                  |...:...:..::.|||.||| |....|...:||:|.|:....
Zfish   272 DKRDAQRKRSKDPLPERKKYERLCRGEGIKLTPRRQSRLFCRYSNNNRNPRLLLAPVKQEDEWDR 336

  Fly   300 PYMVVFHDVIYDTEIDGM-------LNSSNFGLSLTDSGQKSEVRTSKDSYI-----VDAKTLNE 352
            |.:|.:|::|.|:||:.:       |..:.....:|...:.:..|.||.:::     ...:.:|:
Zfish   337 PRIVRYHEIISDSEIETVKEMAKPRLRRATISNPITGVLETAPYRISKSAWLSGYEHSTIERINQ 401

  Fly   353 RVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRPKQ---GDRIATVLFYLGEVDSGG 414
            |:.|:||..|:.::...:.|||:||.|..|:||.........|:   |:||||.|||:.:|.:||
Zfish   402 RIEDVTGLEMDTAEELQVANYGVGGQYEPHFDFGRKDEPDAFKELGTGNRIATWLFYMSDVSAGG 466

  Fly   415 ATIFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLTKWINELPQMFVTPC 478
            ||:|..:...|.||||:|||||||..||..:..:.|:||||:.|:|:|..|||:|..|.|..||
Zfish   467 ATVFTDVGAAVWPKKGTAVFWYNLFPSGEGDYSTRHAACPVLVGNKWVSNKWIHERGQEFRRPC 530

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 36/131 (27%)
metallo-dependent_hydrolases <237..>306 CDD:294200 24/110 (22%)
P4Hc 313..467 CDD:214780 61/169 (36%)
p4ha1bNP_999856.1 P4Ha_N 24..153 CDD:285528 36/131 (27%)
TPR repeat 164..199 CDD:276809 7/35 (20%)
TPR_16 168..238 CDD:290168 13/70 (19%)
TPR repeat 204..234 CDD:276809 5/30 (17%)
P4Hc 347..520 CDD:214780 63/173 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.