DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11052 and acyp1

DIOPT Version :8

Sequence 1:NP_001246977.1 Gene:CG11052 / 49997 FlyBaseID:FBgn0040524 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001116321.1 Gene:acyp1 / 571263 ZFINID:ZDB-GENE-050309-125 Length:99 Species:Danio rerio

Alignment Length:96 Identity:39/97 (40%)
Similarity:58/97 (60%) Gaps:0/97 (0%)


  Fly    52 SDEPVFSCQFEVFGIVQGVSFRMYTLRRAQKLGVRGWCKNTNENTVKGEIQAHRHSFESMRLWLK 116
            |::.:.|..:||:|.||||.||.||....::||:.||.:||:..||:|::|......:.|:.||:
Zfish     3 SEDELLSVDYEVYGRVQGVFFRKYTQTEGKRLGLVGWVQNTDAGTVQGQLQGPVSKVQQMQQWLQ 67

  Fly   117 HTGSPTSRIDKCIFSETTELSEFTFTNFSIV 147
            .||||.|||.|..|.....:.|..|.:|.:|
Zfish    68 TTGSPKSRIAKAEFQNEHPIHELEFKDFKVV 98

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11052NP_001246977.1 Acylphosphatase 56..146 CDD:279097 37/90 (41%)
acyp1NP_001116321.1 Acylphosphatase 9..97 CDD:279097 37/88 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1502266at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127552
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.