DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11052 and acyp1

DIOPT Version :10

Sequence 1:NP_652181.1 Gene:CG11052 / 49997 FlyBaseID:FBgn0040524 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001016160.1 Gene:acyp1 / 548914 XenbaseID:XB-GENE-5909301 Length:98 Species:Xenopus tropicalis


Alignment Length:94 Identity:39/94 - (41%)
Similarity:54/94 - (57%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DEPVFSCQFEVFGIVQGVSFRMYTLRRAQKLGVRGWCKNTNENTVKGEIQAHRHSFESMRLWLKH 117
            :||: |..:||||.||||.||.||.....:||:.||.:||:..||.|::|........|::||:.
 Frog     4 EEPI-SVDYEVFGKVQGVFFRKYTQAEGNRLGLVGWVRNTDTGTVTGQLQGPSEKVREMQIWLQK 67

  Fly   118 TGSPTSRIDKCIFSETTELSEFTFTNFSI 146
            .|||.|||.|..|.....:.:...:.|||
 Frog    68 KGSPKSRITKAQFQNERRIKKLEHSTFSI 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11052NP_652181.1 Acylphosphatase 59..146 CDD:425830 34/86 (40%)
acyp1NP_001016160.1 Acylphosphatase 9..96 CDD:425830 34/86 (40%)

Return to query results.
Submit another query.