DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11052 and Acyp2

DIOPT Version :10

Sequence 1:NP_652181.1 Gene:CG11052 / 49997 FlyBaseID:FBgn0040524 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_650491.1 Gene:Acyp2 / 41910 FlyBaseID:FBgn0038363 Length:102 Species:Drosophila melanogaster


Alignment Length:91 Identity:40/91 - (43%)
Similarity:62/91 - (68%) Gaps:0/91 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VFSCQFEVFGIVQGVSFRMYTLRRAQKLGVRGWCKNTNENTVKGEIQAHRHSFESMRLWLKHTGS 120
            :|:..||:||.||||.||.:|...|::|||||||.||.:.||||:::|...:...|:.||::...
  Fly    10 IFALDFEIFGRVQGVFFRKHTSHEAKRLGVRGWCMNTRDGTVKGQLEAPMMNLMEMKHWLENNRI 74

  Fly   121 PTSRIDKCIFSETTELSEFTFTNFSI 146
            |.:::.|..||:..|:.::|||:|.|
  Fly    75 PNAKVSKAEFSQIQEIEDYTFTSFDI 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11052NP_652181.1 Acylphosphatase 59..146 CDD:425830 38/86 (44%)
Acyp2NP_650491.1 Acylphosphatase 13..100 CDD:425830 38/86 (44%)

Return to query results.
Submit another query.