DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11052 and Acyp

DIOPT Version :8

Sequence 1:NP_001246977.1 Gene:CG11052 / 49997 FlyBaseID:FBgn0040524 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001285916.1 Gene:Acyp / 34807 FlyBaseID:FBgn0025115 Length:120 Species:Drosophila melanogaster

Alignment Length:94 Identity:46/95 (48%)
Similarity:61/95 (64%) Gaps:0/95 (0%)


  Fly    56 VFSCQFEVFGIVQGVSFRMYTLRRAQKLGVRGWCKNTNENTVKGEIQAHRHSFESMRLWLKHTGS 120
            |.||:|||||.||||:||.:.||:|:.||:||||.|::..||||.|:......:.|:.||:.|||
  Fly     6 VHSCEFEVFGRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLRTTGS 70

  Fly   121 PTSRIDKCIFSETTELSEFTFTNFSIVVD 149
            |.|.|:|..||...|...:.:.||.|..|
  Fly    71 PLSSIEKVEFSSQRERDRYGYANFHIKPD 99

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11052NP_001246977.1 Acylphosphatase 56..146 CDD:279097 44/90 (49%)
AcypNP_001285916.1 Acylphosphatase 6..97 CDD:279097 45/91 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131063342
eggNOG 1 0.900 E1_KOG3360
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5255
Isobase 1 0.950 0 Normalized mean entropy S5759
OrthoDB 1 1.010 D1502266at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127552
Panther 1 1.100 P PTHR10029
RoundUp 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.