DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11052 and LOC101733443

DIOPT Version :10

Sequence 1:NP_652181.1 Gene:CG11052 / 49997 FlyBaseID:FBgn0040524 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_004913753.1 Gene:LOC101733443 / 101733443 XenbaseID:XB-GENE-29086975 Length:98 Species:Xenopus tropicalis


Alignment Length:61 Identity:17/61 - (27%)
Similarity:29/61 - (47%) Gaps:8/61 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVASILRIEDQQFTR---ELLAECIGT---FFLLLIGNAANIQAAVAVGGNSTS--CHIAW 59
            |...|:|..:.|::.   :|:||...:   |.|:|.....:..|.||:...|.|  |.|::
 Frog   579 KQGKIIRFSESQWSHAKIDLIAEAGESTLPFQLILEATVLSSNATVALDDISVSQECEISY 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11052NP_652181.1 Acylphosphatase 59..146 CDD:425830 0/1 (0%)
LOC101733443XP_004913753.1 Acylphosphatase 9..94 CDD:425830
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.