DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17450 and Tekt4

Sequence 1:NP_728438.2 Gene:CG17450 FlyBaseID:FBgn0040028 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_082227.1 Gene:Tekt4 MGIID:1919090 Length:447 Species:Mus musculus

Alignment Length:460 Identity:152/461 (33%)
Similarity:242/461 (52%) Gaps:35/461 (8%)


  Fly   140 TKHPWRPAMAYELIQVKHMPEQPVTNQLTKQCFLPKGMKTDGMIFPNLVTGFDRNPQHAARAALY 204
            ||.|     |.:.|.|..:|.:..........:...|:.|.|.                 |.|.|
Mouse     9 TKEP-----APQSIDVCELPRKEYEVACNTGAYTSSGLATAGF-----------------RTAKY 51

  Fly   205 TRYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFW 269
            .|   :||:.|:..:|.::..:|:.|||.|:::.:|:.||...|...|.|:.|::|||:.|:..|
Mouse    52 LR---DEWFQNSYARYHQAFADRDYSERQRHESGQLVAETGALAQRTQLDSTRKVGERLEDMHCW 113

  Fly   270 RNELNAELEKLIAEMSDINELQR-QCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALL 333
            ::||..|:::|.:| :|:...|: :..:||....:|..||.:.|..||.||..:.|.|.||..||
Mouse   114 KSELQREIDELSSE-TDLMMAQKLRLQRALDATSVPYSIATDNLQCRERRQHPDLVRDYVEVELL 177

  Fly   334 VEINNLRNSRDRLGGLHEKISKQALD----CRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGI 394
            .|...:||.::.|    ::...||:|    .|..:...|.:.|.|.....||..|.:..|.|..:
Mouse   178 KETELIRNIQELL----KRTIGQAVDQIRLNREHKESCEMNWSDKVEVYNIDDTCSRYTNESTQV 238

  Fly   395 TYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNA 459
            .:|....||:.|.||.|:||:.:.:::.|::.||.....||.....::...|..:.......|:|
Mouse   239 QFYPHSSKFEESASTPETWAKFNHDNLLRAERERLASVNLRKLIDCILRDTAEDLRLQCDAVNSA 303

  Fly   460 FDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVEL 524
            |..|.||:.::..::|.||:|...|:.|.|..:..|::||:||..||:||||||..||||..|||
Mouse   304 FSSRCQELDDSLQKLQYHLRKTLTEITDQEHQIAALKQAIKDKEAPLRVAQTRLYQRSHRPNVEL 368

  Fly   525 CKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSL 589
            |:|:||.||:.||:::..::..|..||.:||...:.|..:|.:||.|:..|.|:|||||:|||:.
Mouse   369 CRDNAQFRLLSEVEELNMSLRALKEKLQDAEQALRNLEDSRMSLEKDIAVKTNSLFIDRQKCMTH 433

  Fly   590 RRSFP 594
            |..:|
Mouse   434 RNRYP 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17450NP_728438.2 Tektin 212..591 CDD:281184 136/384 (35%)
Tekt4NP_082227.1 Tektin 56..434 CDD:308655 135/383 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2685
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264325at33208
OrthoFinder 1 1.000 FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3872
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.