DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and CYP4F2

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001073.3 Gene:CYP4F2 HGNCID:2645 Length:520 Species:Homo sapiens

Alignment Length:506 Identity:134/507 (26%)
Similarity:237/507 (47%) Gaps:71/507 (14%)


  Fly    17 WFVRTRYSYWTRRGIGSEPARFPVGNMEGFRKNKHFIDIVTPIYEKFKGNGAPFAGFFMMLRPVV 81
            ||       |..:|: ..|..      ||.|.   ...:|....:.||....|.:....:..|.:
Human    59 WF-------WGHQGM-VNPTE------EGMRV---LTQLVATYPQGFKVWMGPISPLLSLCHPDI 106

  Fly    82 LVTDLELAKQILIQD--FANFEDRGMYHNERDDPLTGH-LFRIDGPKWRPLRQKMSPTFTSAKMK 143
            :.:.:..:..|..:|  |.:|.          :|..|. |....|.||...|:.::|.|....:|
Human   107 IRSVINASAAIAPKDKFFYSFL----------EPWLGDGLLLSAGDKWSRHRRMLTPAFHFNILK 161

  Fly   144 -YM--FPTVCEVGEELTQVCGELADNAMCGILEIGDLMARYTSDVIGRCAFGVECNGLRNPEAEF 205
             ||  |.....:.....|:..  ::.:.|  |::.:.::..|.|.:.:|.|..:.:....| :|:
Human   162 PYMKIFNESVNIMHAKWQLLA--SEGSAC--LDMFEHISLMTLDSLQKCVFSFDSHCQEKP-SEY 221

  Fly   206 --AIMGRRAFSERRHCKL---VDGFIESFPEVARFLRMRQIHQDITDFYVGIVRETVKQREEQGI 265
              ||:...|...:||.::   :|......|:..||.|..::..|.||   .:::|..:....||:
Human   222 IAAILELSALVSKRHHEILLHIDFLYYLTPDGQRFRRACRLVHDFTD---AVIQERRRTLPSQGV 283

  Fly   266 -------VRS---DFMNLLIEMKQRG--ELTIEEMAAQAFIFFAAGFDTSASTLGFALYELAKQP 318
                   .:|   ||:::|:..|...  :|:.|::.|:|..|...|.||:||.|.:.||.|||.|
Human   284 DDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHP 348

  Fly   319 ALQAKLREEIDQALR-LHNGEFTYDSMQELRYMELVIAETLRKYPILPQLTR-ISRHLYAAKGDR 381
            ..|.:.|:|:.:.|: ....|..:|.:..|.::.:.:.|:||.:|.:|.::| :::.:....|. 
Human   349 EYQERCRQEVQELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGR- 412

  Fly   382 HFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRPTAAWLPFGDGPRNCIGMRFGK 446
              .|..|.:.||.|:|.||:||::|:|..:.|.||..:.:.:|...|::||..|||||||..|..
Human   413 --VIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAM 475

  Fly   447 MQTTIGL-VSLLRNFHFSVCP-RTDPKIEFLKSNILLCPANGIYLKVQQLS 495
            .:..:.| ::|||   |.|.| .|:|:   .|..::|....|::|:|:.||
Human   476 AEMKVVLALTLLR---FRVLPDHTEPR---RKPELVLRAEGGLWLRVEPLS 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 127/483 (26%)
CYP4F2NP_001073.3 p450 52..515 CDD:278495 131/500 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.