DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and CYP735A1

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_198661.1 Gene:CYP735A1 AraportID:AT5G38450 Length:518 Species:Arabidopsis thaliana

Alignment Length:428 Identity:118/429 (28%)
Similarity:189/429 (44%) Gaps:85/429 (20%)


  Fly    79 PVVLVTDLELAKQILI-------------QDFANFEDRGMYHNERDDPLTGHLFRIDGPKWRPLR 130
            |.:.:|:.||.|::|:             |...||..||             |...:|..|...|
plant   105 PRLCLTETELIKELLMKHNGVSGRSWLQQQGTKNFIGRG-------------LLMANGQDWHHQR 156

  Fly   131 QKMSPTFTSAKMK----YMFPTVCEVGEELTQVCGELADNAMCGILEIGDLMARYTSDVIGRCAF 191
            ...:|.||..::|    :|.....::.|.|.:..||.|:.     :|||:.|.:.|:|:|.|..|
plant   157 HLAAPAFTGERLKGYARHMVECTSKLVERLRKEVGEGANE-----VEIGEEMHKLTADIISRTKF 216

  Fly   192 GVECNGLRNPEAEFAIMGRRAFSERRH-CKLVDGFIESFPEVARFL------RMRQIHQDITDFY 249
            |......:.......::.||.....|| |         ||. :|||      .::.:.:::....
plant   217 GSSFEKGKELFNHLTVLQRRCAQATRHLC---------FPG-SRFLPSKYNREIKSLKKEVERLL 271

  Fly   250 VGIVRETVKQREEQGIVRS-----DFMNLLI-EM-----KQRGELTIEEMAAQAFIFFAAGFDTS 303
            :.|::   .:|:...:.||     |.:.||: ||     .......::.:..:...||.||.:|:
plant   272 IEIIQ---SRRDCAEMGRSSTHGDDLLGLLLNEMDIDKNNNNNNNNLQLIMDECKTFFFAGHETT 333

  Fly   304 ASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQELRYMELVIAETLRKYP---ILP 365
            |..|.:....||..|..|.|:|||:.:... .||..:.|.:.:|..:..||.|:||.||   :||
plant   334 ALLLTWTTMLLADNPTWQEKVREEVREVFG-RNGLPSVDQLSKLTSLSKVINESLRLYPPATLLP 397

  Fly   366 QLTRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALY-PEPHKFIPERFLADQLAQRPTAA- 428
            ::......|    ||  ..|..|..:.|||..|||...|: .:.::|.||||     ..||.|: 
plant   398 RMAFEDLKL----GD--LTIPKGLSIWIPVLAIHHSEELWGKDANQFNPERF-----GGRPFASG 451

  Fly   429 --WLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSV 464
              ::||..|||||||.:|..|:..|.|.:|:..|:|::
plant   452 RHFIPFAAGPRNCIGQQFALMEAKIILATLISKFNFTI 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 118/429 (28%)
CYP735A1NP_198661.1 PLN02290 1..518 CDD:215164 118/429 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.