DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and CYP714A1

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_568463.1 Gene:CYP714A1 AraportID:AT5G24910 Length:532 Species:Arabidopsis thaliana

Alignment Length:541 Identity:134/542 (25%)
Similarity:234/542 (43%) Gaps:113/542 (21%)


  Fly    17 WFVRTRYSYWTRRGIGSEPARFPVGNMEGFRK--------NKHFI--DIVT--------PIYEKF 63
            |.:|.:.   |.:|:...|.....||:...:|        :||:.  :|:.        |..:.:
plant    36 WRMRRKL---TMQGVKGPPPSLFRGNVPEMQKIQSQIMSNSKHYSGDNIIAHDYTSSLFPYLDHW 97

  Fly    64 KGNGAPFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRG--MYHNERDDPLTGH-LFRIDGPK 125
            :........:...::..:.:...||.|::   :.||..:.|  .|..:|...:.|. :...:||.
plant    98 RKQYGRVYTYSTGVKQHLYMNHPELVKEL---NQANTLNLGKVSYVTKRLKSILGRGVITSNGPH 159

  Fly   126 WRPLRQKMSPTFTSAKMKYMFPTVCEVG-------EELTQVCGELADNAMCGILEIGDLMARYTS 183
            |...|:.::|.|...|:|.|...|.|..       ||:.:..||:    :|.|:...||.|. ::
plant   160 WAHQRRIIAPEFFLDKVKGMVGLVVESAMPMLSKWEEMMKREGEM----VCDIIVDEDLRAA-SA 219

  Fly   184 DVIGRCAFGVECNGLRNPEAEFAIMGRRAFSERR-------HCKL---VDGFIE----------- 227
            |||.|..||          :.|: .|:..||:.|       |..:   ::||.:           
plant   220 DVISRACFG----------SSFS-KGKEIFSKLRCLQKAITHNNILFSLNGFTDVVFGTKKHGNG 273

  Fly   228 SFPEVARFLRMRQIHQDITDFYVGIVRETVKQREEQ--GIVRSDFMNLLIEMKQR---GELTIEE 287
            ...|:.|.:.             .::.||||:||.:  |..:.|.|.|::|..:.   |.|..:.
plant   274 KIDELERHIE-------------SLIWETVKERERECVGDHKKDLMQLILEGARSSCDGNLEDKT 325

  Fly   288 MAAQAFI------FFAAGFDTSASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQE 346
            .:.::|:      .:.||.:|||..:.:.|..||..|:.|.::|:|:  .|...||....||:..
plant   326 QSYKSFVVDNCKSIYFAGHETSAVAVSWCLMLLALNPSWQTRIRDEV--FLHCKNGIPDADSISN 388

  Fly   347 LRYMELVIAETLRKYPILPQLTRISRHLYAAKGDRHFYIEPGQML--LIPVYGIHHDPALY-PEP 408
            |:.:.:||.||||.|   |....:||.........:..:..|..:  |||.  :|.||.:: .:.
plant   389 LKTVTMVIQETLRLY---PPAAFVSREALEDTKLGNLVVPKGVCIWTLIPT--LHRDPEIWGADA 448

  Fly   409 HKFIPERFL--ADQLAQRPTAAWLPFGDGPRNCIGMRFGKMQTTIGLVSLL-RNFHFSVCPRTDP 470
            ::|.||||.  ..:..:.| .:::|||.|.|.|:|..||.|:..: ||||: ..|.|::.|....
plant   449 NEFNPERFSEGVSKACKHP-QSFVPFGLGTRLCLGKNFGMMELKV-LVSLIVSRFSFTLSPTYQH 511

  Fly   471 KIEFLKSNILLCPANGIYLKV 491
            ...|   .:|:.|.:|:.::|
plant   512 SPVF---RMLVEPQHGVVIRV 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 129/522 (25%)
CYP714A1NP_568463.1 p450 37..530 CDD:299894 133/541 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.