DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and CYP709B3

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_194501.1 Gene:CYP709B3 AraportID:AT4G27710 Length:518 Species:Arabidopsis thaliana

Alignment Length:531 Identity:118/532 (22%)
Similarity:203/532 (38%) Gaps:112/532 (21%)


  Fly     1 MLDVVALLLIALAV--GFWFVRTRYSYWTRR----GIGSEPARFPVGNMEGFRKNKHFIDI---- 55
            :|.:|.||.:...:  ..|.:..|....::|    ||.....:...||:...:|.|...|:    
plant     9 LLTIVLLLFVVSKIWKACWILLLRPLMLSKRFKKQGISGPKYKILYGNLSEIKKMKKEADLCVLD 73

  Fly    56 ---------VTPIYEKFKGNGAPFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERD 111
                     |.|.|.::.........|:...:|.:.:::.|||||:|...|      |.......
plant    74 PNSNDIFPRVFPQYHQWMSQYGDTFLFWTGTKPTIYISNHELAKQVLSSKF------GFTIIPVK 132

  Fly   112 DPLTGHLFR-----IDGPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCGI 171
            .|....||.     |.|..|...|:.::|.|:..::|.|           ||..|:      |.:
plant   133 RPEVFILFGKGLSFIQGDDWIRHRRILNPAFSMDRLKAM-----------TQPMGD------CTL 180

  Fly   172 ------------------LEIGDLMARYTSDVIGRCAFGVECNGLRNPEAEFAIMGRRAFSE--- 215
                              :||.....:.|:|:|...|||                  .:::|   
plant   181 RIFEEWRKQRRNGEVLIKIEISKEFHKLTADIIATTAFG------------------SSYAEGIE 227

  Fly   216 --RRHCKLVDGFIESFPEV----------ARFLRMRQIHQDITDFYVGIVRETVKQREEQGIVRS 268
              |...:|...:|.|...|          ...|::.::|:.:.:....|:...:|.:.:......
plant   228 LCRSQTELEKYYISSLTNVFIPGTQYLPTPTNLKLWELHKKVKNSIKRIIDSRLKSKCKTYGYGD 292

  Fly   269 DFMNLLIEMKQRGE----LTIEEMAAQAFIFFAAGFDTSASTLGFALYELAKQPALQAKLREEID 329
            |.:.:::...:..|    :.::|:..:...|:.||..|::..|.:....|:.....|.|||||:.
plant   293 DLLGVMLTAAKSNEYERKMRMDEIIEECKNFYYAGQGTTSILLTWTTMLLSLHQGWQEKLREEVF 357

  Fly   330 QALRLHNGEFTYDSMQELRYMELVIAETLRKY-PILPQLTRISRHLYAAKGDRHFYIEPGQMLLI 393
            ..........| |:..:|:.|.:|:.|:||.| |::    :|||.........|..|..|..::|
plant   358 NECGKDKIPDT-DTFSKLKLMNMVLMESLRLYGPVI----KISREATQDMKVGHLEIPKGTSIII 417

  Fly   394 PVYGIHHDPALYPE-PHKFIPERFL--ADQLAQRPTAAWLPFGDGPRNCIGMRFGKMQTTIGLVS 455
            |:..:|.|.|::.| ..:|.|.||.  ..|....|.|. |||..|||.||...|..::....|..
plant   418 PLLKMHRDKAIWGEDAEQFNPLRFENGISQATIHPNAL-LPFSIGPRACIAKNFAMVEAKTVLTM 481

  Fly   456 LLRNFHFSVCP 466
            :|:.|..|:.|
plant   482 ILQQFQLSLSP 492

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 109/492 (22%)
CYP709B3NP_194501.1 p450 9..517 CDD:299894 118/532 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.