DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and CYP71B4

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001325927.1 Gene:CYP71B4 AraportID:AT3G26280 Length:521 Species:Arabidopsis thaliana

Alignment Length:492 Identity:115/493 (23%)
Similarity:211/493 (43%) Gaps:64/493 (13%)


  Fly     8 LLIALAVGFWFVRTRYSYWTRRGIGSEPARFP-VGNMEGFRKNKHFIDIVTPIYEKFKGNGAPFA 71
            ||:.:.:.|..:.|:....:::.:...||:.| :||:...:...|     ..:::..|.:| |..
plant    26 LLLLVPIFFLLIFTKKIKESKQNLPPGPAKLPIIGNLHQLQGLLH-----KCLHDLSKKHG-PVM 84

  Fly    72 GFFMMLRPVVLVTDLELAKQIL-IQDF------ANFEDRGMYHNERDDPLTGHLFRIDGPKWRPL 129
            ...:...|:|:::..|.|::.| ..|.      .....|....|.:|   .|  |.:.|.:||.|
plant    85 HLRLGFAPMVVISSSEAAEEALKTHDLECCSRPITMASRVFSRNGKD---IG--FGVYGDEWREL 144

  Fly   130 RQKMSPTFTSAKMKYMFPTVCEVGEEL-TQVCGELADNAMCGILEIGDLMARYTSDVIGRCAFG- 192
            |:.....|.|.|....|..:.|...:| .:...|||...  ..:::..::...|:.:|.|.||| 
plant   145 RKLSVREFFSVKKVQSFKYIREEENDLMIKKLKELASKQ--SPVDLSKILFGLTASIIFRTAFGQ 207

  Fly   193 -------VECNGLRNPEAEFAIMGRRAFSERRHCKLVDGFIESFPEV----------ARFLRMRQ 240
                   |:...::  |..|..:....|.          |.:.||..          .:..|:..
plant   208 SFFDNKHVDQESIK--ELMFESLSNMTFR----------FSDFFPTAGLKWFIGFVSGQHKRLYN 260

  Fly   241 IHQDITDFYVGIVRETVKQREEQGIVRSDFMNLLIEMKQRGE------LTIEEMAAQAFIFFAAG 299
            :...:..|:..||.:...::..|.  |.|.::.:::|....:      ||::.:.......:.||
plant   261 VFNRVDTFFNHIVDDHHSKKATQD--RPDMVDAILDMIDNEQQYASFKLTVDHLKGVLSNIYHAG 323

  Fly   300 FDTSASTLGFALYELAKQPALQAKLREEIDQALRL-HNGEFTYDSMQELRYMELVIAETLRKYPI 363
            .||||.||.:|:.||.:.|.:..|.::||...:.: ..|....:.:.:|:|::||:.||||.:|.
plant   324 IDTSAITLIWAMAELVRNPRVMKKAQDEIRTCIGIKQEGRIMEEDLDKLQYLKLVVKETLRLHPA 388

  Fly   364 LPQLTRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQR-PTA 427
            .|.|  :.|...|....:.:.|...:.||:..:.|..||..:..|.:|.||||:...:..: .:.
plant   389 APLL--LPRETMADIKIQGYDIPQKRALLVNAWSIGRDPESWKNPEEFNPERFIDCPVDYKGHSF 451

  Fly   428 AWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSV 464
            ..||||.|.|.|.|:........:||::||..|.:::
plant   452 ELLPFGSGRRICPGIAMAIATIELGLLNLLYFFDWNM 488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 111/466 (24%)
CYP71B4NP_001325927.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.