DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and CYP72A10

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_188082.2 Gene:CYP72A10 AraportID:AT3G14640 Length:536 Species:Arabidopsis thaliana

Alignment Length:552 Identity:134/553 (24%)
Similarity:242/553 (44%) Gaps:107/553 (19%)


  Fly     5 VALLLIALAVGFWFVRTRY----------SYWTRRGIGSEPARFPVGNM--------EGFRKNKH 51
            |.:.::.:.|.:|..||..          ||..|:|:...|....:|::        |...|...
plant    30 VTVSVVVVVVSWWVWRTLQWVWFKPKMLESYLRRQGLAGTPYTPLIGDLKRNVNMLTEATSKPIK 94

  Fly    52 FIDIVTP-----IYEKFKGNGAPFAGFFMML--RPVVLVTDLELAKQILIQDFANFEDRGMYHNE 109
            ..:.:||     .::..|.:|..   ||..|  :|.:.:.|.||.|::             ::..
plant    95 LTEDITPRVLPHPFQMLKTHGRT---FFTWLGPKPTITIMDPELIKEV-------------FNKV 143

  Fly   110 RDDP-----LTGHL-----FRIDGPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGE-- 162
            .|.|     |.|.|     ...||.||...|:.::|.|...|:|.|.|.   ..:..:.|.||  
plant   144 YDYPKAQTFLLGRLIATGIINYDGDKWAKHRRIINPAFHIEKIKNMVPA---FHQSCSDVVGEWS 205

  Fly   163 --LAD--NAMCGILEIGDLMARYTSDVIGRCAFGVECNGLRNPEAEFAIMGRRAFSERRHCKLVD 223
              ::|  ::.|.: ::...:...|.|||.|.|||....           .|:|.|  ....:||.
plant   206 KLVSDKGSSSCEV-DVWPWLVSMTGDVISRTAFGSSYK-----------EGQRIF--ELQAELVH 256

  Fly   224 GFIESFPEV----ARFL------RMRQIHQDITDFYVGIVRETVKQREE-QGIVRSDFMNLLIEM 277
            ..:::|.:|    .|:|      ||:...::|.....|||.:.::.||. :.....|.:.:|:|.
plant   257 LILQAFWKVYIPGYRYLPTKSNRRMKAAAREIQVILKGIVNKRLRAREAGKAAPNDDLLGILLES 321

  Fly   278 ---KQRGE-LTIEEMAAQAFIFFAAGFDTSASTLGFALYELAKQPALQAKLREEIDQALRLHNGE 338
               :.:|. ::.|::..:..:|:.||.:|::..|.:|:..|:.....||:.|||:.|..    |:
plant   322 NLGQAKGNGMSTEDVMEECKLFYFAGQETTSVLLVWAMVLLSHHQDWQARAREEVKQVF----GD 382

  Fly   339 FTYDS--MQELRYMELVIAETLRKYPILPQLTR-ISRHLYAAKGDRHFYIEPGQMLLIPVYGIHH 400
            ...|:  :.:|:.|.:::.|.||.||.:..||| |.:.:  ..||  ..:..|..:.:|:..:..
plant   383 KEPDTECLSQLKVMTMILYEVLRLYPPVTHLTRAIDKEM--KLGD--LTLPAGVHISLPIMLVQR 443

  Fly   401 DPALY-PEPHKFIPERFLADQL--AQRPTAAWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHF 462
            ||.|: .:..:|.|||| .|.|  |.:...::.||..|||.|||..|..::..:.:..:|:.|.|
plant   444 DPMLWGTDAAEFKPERF-KDGLSKATKSQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQTFTF 507

  Fly   463 SVCPRTDPKIEFLKSNILLCPANGIYLKVQQL 494
            .:.|   ..:...::.:.:.|..|.:|.:::|
plant   508 ELSP---SYVHAPQTVVTIHPQFGAHLILRKL 536

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 124/508 (24%)
CYP72A10NP_188082.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.