DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and CYP72A8

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_188080.1 Gene:CYP72A8 AraportID:AT3G14620 Length:515 Species:Arabidopsis thaliana

Alignment Length:524 Identity:132/525 (25%)
Similarity:231/525 (44%) Gaps:105/525 (20%)


  Fly     4 VVALLLIALAVGFWF----------VRTRYSYWTRRGIGSEPARFPVGNMEGFRKNKHFID---- 54
            |.|.:::...|..|.          .:...:|..|:|:...|..|.||::   ::....::    
plant    11 VAAAVVVVTTVTVWIWKGLNVAWLRPKKNEAYLKRQGLSGTPFTFLVGDI---KREASMVEQEKS 72

  Fly    55 ------------IVTPIYEKFKGNGAPFAGFFMMLRPV--VLVTDLELAKQIL--IQDFANFEDR 103
                        ::..|.:..|.:|..   .:|.:.|:  |:||..|..|.:|  :.||    .:
plant    73 RPINLTDDYTHRVMPLIQQTVKDHGKT---SYMWMGPIASVIVTKPEHIKDVLNRVYDF----PK 130

  Fly   104 GMYHNERDDPLTGHLFR-----IDGPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGEL 163
            ...|     |:. .||.     .:|.||...|:.::|:|...|:|.|.|...|...|:.....:|
plant   131 PPVH-----PIV-ELFATGVALYEGEKWSKHRKIINPSFHLEKLKIMIPAFYESCSEMISKWEKL 189

  Fly   164 -ADNAMCGILEIGDLMARYTSDVIGRCAFGVECNGLRNPEAEFAIMGRRAF-----SERRHCKLV 222
             .:......:::...:...|||||.|.|||....           .|:|.|     ..||..|.:
plant   190 VTEQGSSNEIDVWPYLGDLTSDVISRTAFGSSYE-----------EGKRIFELQEEQGRRVLKAL 243

  Fly   223 D-GFIES--FPEVARFLRMRQIHQDITDFYVGIVRETVKQREEQGI-----VRSDFMNLLIEMKQ 279
            : .||..  |......||||||::::.    ..:||.:.:| ::|:     .::|.:.:|:| ..
plant   244 ELAFIPGMRFLPTKNNLRMRQINKEVK----SRLREIIMKR-QRGMDTGEAPKNDLLGILLE-SN 302

  Fly   280 RGE--LTIEEMAAQAFIFFAAGFDTSASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYD 342
            .|:  ::||::..:..:|..||.:|:|..|.:.:..|:.....|.:.||||.:.:. .|.:..:|
plant   303 SGDHGMSIEDVVEECRLFHFAGQETTAVLLVWTMIMLSHHQKWQDQAREEILKVIG-KNNKPNFD 366

  Fly   343 SMQELRYMELVIAETLRKYP-------ILPQLTRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHH 400
            ::..|:.|.:::.|.||.||       .:.:.|::...:         .:..|..::|||..:|.
plant   367 ALSRLKTMSMILNEVLRLYPPGILLGRTVEKETKLGEDM---------TLPGGAQVVIPVLMVHR 422

  Fly   401 DPALYPEP-HKFIPERFLADQL--AQRPTAAWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHF 462
            ||.|:.|. |:|.|||| ||.:  |.:...::||||.|||.|.|..|..|:..:.||.:|:.|.|
plant   423 DPELWGEDVHEFNPERF-ADGISKATKNQVSFLPFGWGPRFCPGQNFALMEAKMALVLILQRFSF 486

  Fly   463 SVCP 466
            .:.|
plant   487 ELSP 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 125/484 (26%)
CYP72A8NP_188080.1 p450 26..515 CDD:299894 128/510 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.