DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and CYP4F12

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_076433.3 Gene:CYP4F12 HGNCID:18857 Length:524 Species:Homo sapiens

Alignment Length:544 Identity:132/545 (24%)
Similarity:229/545 (42%) Gaps:99/545 (18%)


  Fly     8 LLIALAVGFWFVRTRYSYWT--------RRGIGSEPARFPVGNMEGFRKNKHF---IDIVTPIYE 61
            ||:.|.||.|.: .|...||        |.....:|.           |...|   :.::||..|
Human    20 LLLLLVVGSWLL-ARILAWTYAFYNNCRRLQCFPQPP-----------KRNWFWGHLGLITPTEE 72

  Fly    62 KFKGN---GAPFA-GFFMMLRPVV------------LVTDLELA----KQILIQDFANFEDRGMY 106
            ..|.:   .|.:: ||.:.|.|::            .:|:...|    ..:.|:....:...|:.
Human    73 GLKNSTQMSATYSQGFTVWLGPIIPFIVLCHPDTIRSITNASAAIAPKDNLFIRFLKPWLGEGIL 137

  Fly   107 HNERDDPLTGHLFRIDGPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCGI 171
                   |:|      |.||...|:.::|.|....:|.......:....:......||... ...
Human   138 -------LSG------GDKWSRHRRMLTPAFHFNILKSYITIFNKSANIMLDKWQHLASEG-SSR 188

  Fly   172 LEIGDLMARYTSDVIGRCAFGVECNGLRNPEAEFA-IMGRRAFSERRHCKLV-----------DG 224
            |::.:.::..|.|.:.:|.|..:.:....|....| |:...|..|:|...::           ||
Human   189 LDMFEHISLMTLDSLQKCIFSFDSHCQERPSEYIATILELSALVEKRSQHILQHMDFLYYLSHDG 253

  Fly   225 FIESFPEVARFLRMRQIHQDITDFYVGIVRETVKQREEQGI-------VRS---DFMNLLIEMKQ 279
                    .||.|..::..|.||   .::||..:....|||       .:|   ||:::|:..|.
Human   254 --------RRFHRACRLVHDFTD---AVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDVLLLSKD 307

  Fly   280 RG--ELTIEEMAAQAFIFFAAGFDTSASTLGFALYELAKQPALQAKLREEIDQALRLHN-GEFTY 341
            ..  .|:.|::.|:|..|...|.||:||.|.:.||.||:.|..|.:.|:|:.:.|:..: .|..:
Human   308 EDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDRDPKEIEW 372

  Fly   342 DSMQELRYMELVIAETLRKYPILPQLTRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYP 406
            |.:.:|.::.:.:.|:||.:|..|.::|...........|  .|..|...||.:.|:||:|.::|
Human   373 DDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGR--VIPKGITCLIDIIGVHHNPTVWP 435

  Fly   407 EPHKFIPERFLADQLAQRPTAAWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPK 471
            :|..:.|.||..:....|...|::||..|||||||..|...:..:.|..:|.:|.| :...|:|:
Human   436 DPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFRF-LPDHTEPR 499

  Fly   472 IEFLKSNILLCPANGIYLKVQQLS 495
               .|..:::....|::|:|:.|:
Human   500 ---RKLELIMRAEGGLWLRVEPLN 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 120/504 (24%)
CYP4F12NP_076433.3 p450 52..506 CDD:306555 118/496 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.