DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and Cyp3a25

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_062766.2 Gene:Cyp3a25 MGIID:1930638 Length:503 Species:Mus musculus

Alignment Length:528 Identity:147/529 (28%)
Similarity:255/529 (48%) Gaps:79/529 (15%)


  Fly     2 LDVVALLLIALAVGFWFVRTRYSYWTRRGIG-SEPARFP-VGNMEGFRKNKHFIDIVTPIYEKFK 64
            |.:...:|:..::..:::...||:...:.:| ..|...| :|.:..:.......|  ...|:|: 
Mouse     7 LSIETWVLLVTSLVLFYIYGTYSHGLFKKLGIPGPKPLPLLGTIFNYYDGMWKFD--EDCYKKY- 68

  Fly    65 GNGAPFAGFFMMLRPVVLVTDLELAKQILIQD-FANFEDRGMYHNERDDPLTGHLFRIDGP---- 124
               ....||:...:|::.:.|.|:.|.:|::: ::.|.:|                |..||    
Mouse    69 ---GKIWGFYEGPQPILAIMDPEIIKIVLVKECYSVFTNR----------------RFFGPVGFM 114

  Fly   125 ----------KWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELT------QVCGELADNAMCGILE 173
                      :|:.||..:||||||.|:|.|||.:.:.|:.|.      :..||        .:.
Mouse   115 KKAITISEDEEWKRLRTLLSPTFTSGKLKEMFPIMRQYGDILVRNLRREEEKGE--------PIS 171

  Fly   174 IGDLMARYTSDVIGRCAFGVECNGLRNPEAEFAIMGRRAFSERRHCKLVDGFIES---FP---EV 232
            :.|:...|:.|||...:|||..:.|.||:..|....::...    .|:.|.|:.|   ||   .:
Mouse   172 MKDIFGAYSMDVITGTSFGVNVDSLNNPQDPFVQKAKKILK----FKIFDPFLLSIILFPFLTPI 232

  Fly   233 ARFLRMRQIHQDITDFYVGIVRETVKQR---EEQGIVRSDFMNLLIE-MKQRGE-----LTIEEM 288
            ...|......:|..:|:...|:...|:|   .::.  |.||:.|::. ...:|:     |:..||
Mouse   233 YEMLNFSIFPRDSMNFFKKFVKRMKKERLASNQKN--RVDFLQLMMNTQNSKGQESQKALSDLEM 295

  Fly   289 AAQAFIFFAAGFDTSASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQELRYMELV 353
            ||||.||...|:|.:::::...:||||..|.:|.||::|||:.|. :....|||::.::.|:::|
Mouse   296 AAQAVIFIFGGYDATSTSISLIMYELATHPDVQKKLQDEIDRTLP-NKAPVTYDALMDMEYLDMV 359

  Fly   354 IAETLRKYPILPQLTRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLA 418
            :.|:||.|||..:|.|:|:......|   .:|..|.:::||:|.:|.:|..:|||.:|.||||..
Mouse   360 VNESLRLYPIAIRLERVSKKDVEING---VFIPKGTVVMIPIYPLHRNPEYWPEPQEFCPERFSK 421

  Fly   419 DQLAQRPTAAWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKIEFLKSNILLCP 483
            :.........::|||:||||||||||..:...:.::.:|:||....|..|...::..:..|.. |
Mouse   422 ENKGNIDPYIYMPFGNGPRNCIGMRFALISIKLAVIGVLQNFTVQPCEETQIPLKISREPIFQ-P 485

  Fly   484 ANGIYLKV 491
            ...|.|||
Mouse   486 EKPIILKV 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 141/493 (29%)
Cyp3a25NP_062766.2 p450 39..493 CDD:278495 141/495 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.