DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and Cyp4d14

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001259179.1 Gene:Cyp4d14 FlyBaseID:FBgn0023541 Length:510 Species:Drosophila melanogaster

Alignment Length:575 Identity:125/576 (22%)
Similarity:218/576 (38%) Gaps:165/576 (29%)


  Fly     2 LDVVALLL-IALAVGFWFVRTRYSYWTRRGIGSEPARFP-VGNM-----EGFRKNKHFIDIVTPI 59
            |::.|:|| .|||..:...|.....:...||.. |..:| |||.     |..:......|:...:
  Fly     3 LELFAILLATALAWDYMRKRRHNKMYAEAGIRG-PKSYPLVGNAPLLINESPKSKSSIFDMQFRL 66

  Fly    60 YEKFKGN------GAPFAGFF---MMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLT 115
            ..:|..|      |.  :||.   ..:...::.:...:.|..|.....|:...|:..::      
  Fly    67 IAEFGKNIKTQMLGE--SGFMTADSKMIEAIMSSQQTIQKNNLYSLLVNWLGDGLLISQ------ 123

  Fly   116 GHLFRIDGPKWRPLRQKMSPTF-----------------TSAKMKY----------MFPTVCEVG 153
                   |.||...|:.::|.|                 |..:..|          |||..|   
  Fly   124 -------GKKWFRRRKIITPAFHFKILEDFVEVFDQQSATMVQKLYDRADGKTVINMFPVAC--- 178

  Fly   154 EELTQVCGELADNAMCGILEIGDLMARYTSDVIGRCAFGVECNGLRNPEAEF--------AIMGR 210
                          :|.:            |:|...|.||:.|....|:..:        |::..
  Fly   179 --------------LCAM------------DIIAETAMGVKINAQLQPQFTYVQSVTTASAMLAE 217

  Fly   211 RAFSERR---------HCKLVDGFIESFPEVARF-----LRMRQIHQ----DITDFYVGIVRETV 257
            |..:..:         :.||:|...::...:..|     ...|::.|    |..|....::.:..
  Fly   218 RFMNPLQRLDFTMKLFYPKLLDKLNDAVKNMHDFTNSVITERRELLQKAIADGGDADAALLNDVG 282

  Fly   258 KQREEQGIVRSDFMNLLIEMKQRG-ELTIEEMAAQAFIFFAAGFDTSASTLGFALYELAKQPALQ 321
            ::|      |...:::|::....| .|:.:::..:...|...|.||:.|::.|..|.||:.|.:|
  Fly   283 QKR------RMALLDVLLKSTIDGAPLSNDDIREEVDTFMFEGHDTTTSSIAFTCYLLARHPEVQ 341

  Fly   322 AKLREEIDQALRLHNGE-----FTYDSMQELRYMELVIAETLRKYPILPQLTRISRHLYAAKGDR 381
            |::.:|:...:    |:     .|...:.||:|:|.||.|:||.:|.:|.:.|            
  Fly   342 ARVFQEVRDVI----GDDKSAPVTMKLLGELKYLECVIKESLRLFPSVPIIGR------------ 390

  Fly   382 HFYIEPGQML---LIP--------VYGIHHDPALYPEPHKFIPERFLADQLAQRPTAAWLPFGDG 435
              ||....:|   |||        :|....||..:|:|.||||:||..::..:....|:.||..|
  Fly   391 --YISQDTVLDGKLIPADSNVIILIYHAQRDPDYFPDPEKFIPDRFSMERKGEISPFAYTPFSAG 453

  Fly   436 PRNCIGMRFGKMQTTIGLVSLLRNFHFSVCP---RTDPKIEFLKSNILLCPANGI 487
            ||||||.:|..::....:..::|  ||.:.|   ...|.:     |::|....||
  Fly   454 PRNCIGQKFAMLEMKSTISKMVR--HFELLPLGEEVQPVL-----NVILRSTTGI 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 115/542 (21%)
Cyp4d14NP_001259179.1 p450 34..489 CDD:278495 110/526 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.