DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and Cyp4e1

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_524771.1 Gene:Cyp4e1 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster

Alignment Length:531 Identity:125/532 (23%)
Similarity:213/532 (40%) Gaps:119/532 (22%)


  Fly    15 GFW--FVRTRYSYWTRRGIGSEPARFPVGNMEGFRKNKHFIDIVTPIYEKFKGNGAPFAGFFMML 77
            |:|  :.:..:.||.                 |:..|   |.:..|.|.:|              
  Fly    61 GWWHEYGKDNFRYWI-----------------GYYSN---IMVTNPKYMEF-------------- 91

  Fly    78 RPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLTG-HLFRIDGPKWRPLRQKMSPTFTSAK 141
                     .|:.|.||.....::   :.|     |..| .|....|.||...|:.::|.|....
  Fly    92 ---------ILSSQTLISKSDVYD---LTH-----PWLGLGLLTSTGSKWHKHRKMITPAFHFNI 139

  Fly   142 MKYMFPTVCEVGEELTQVCGELADNAMCGILEIGDLMARYTSDVIGRCAFGVECNGLRNPEAEFA 206
            ::.....:.|...:......::||..  .|.:..:.....|.|||...|.||..|.:.|..:...
  Fly   140 LQDFHEVMNENSTKFIDQLKKVADGG--NIFDFQEEAHYLTLDVICDTAMGVSINAMENRSSSVV 202

  Fly   207 --------IMGRRAFSERRHCKLVDGFIESFPEVARFLRMRQIHQDITDFYVGIVRETVKQRE-- 261
                    .:..||||..:..|.:..|...:||.::.|:..|      ||...|:.:.::.|:  
  Fly   203 QAFKDITYTIKMRAFSPWKRNKYLFHFAPEYPEYSKTLKTLQ------DFTNEIIAKRIEVRKSG 261

  Fly   262 -EQGIVRSD-------FMNLLIEMKQRGE-LTIEEMAAQAFIFFAAGFDTSASTLGFALYELAKQ 317
             |.||...:       |::.|:..|..|. ||.:|:..:...|...|.||:.|.:|||:|.|::.
  Fly   262 LEVGIKADEFSRKKMAFLDTLLSSKVDGRPLTSQELYEEVSTFMFEGHDTTTSGVGFAVYLLSRH 326

  Fly   318 PALQAKL-REEIDQALRLHNG-EFTYDSMQELRYMELVIAETLRKYPILPQLTRISRHLYAAKGD 380
            |..|.|| .|:.|.......| :.|:..:..:::::|.|.|..|.||.:|.:.|.:...|...||
  Fly   327 PDEQEKLFNEQCDVMGASGLGRDATFQEISTMKHLDLFIKEAQRLYPSVPFIGRFTEKDYVIDGD 391

  Fly   381 RHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRPTAAWLPFGDGPRNCIGMRFG 445
               .:..|..|.:.:..:.::..::.:||||.||||  |:....| ..::||..|||||||.:|.
  Fly   392 ---IVPKGTTLNLGLLMLGYNDRVFKDPHKFQPERF--DREKPGP-FEYVPFSAGPRNCIGQKFA 450

  Fly   446 KMQTTIGLVSLLRNFHFSVCPRTDPKIE---FLKSNILLCPA----------------------- 484
            .::....:..::||  |.|.|..|..:.   ::.:.:.|.||                       
  Fly   451 LLEIKTVVSKIIRN--FEVLPALDELVSKDGYISTTLGLQPAEKKSRDAHNHKYDPILSASMTLK 513

  Fly   485 --NGIYLKVQQ 493
              ||::|:::|
  Fly   514 SENGLHLRMKQ 524

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 120/506 (24%)
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 116/475 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.