DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and cyp-25A3

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001040850.1 Gene:cyp-25A3 WormBaseID:WBGene00014697 Length:502 Species:Caenorhabditis elegans

Alignment Length:513 Identity:139/514 (27%)
Similarity:247/514 (48%) Gaps:54/514 (11%)


  Fly     4 VVALLLIALAVGF--WFVRTRYSYWTRRG----IGSEPARFPVGNMEGF--RKNKHFIDIVTPIY 60
            ::..:|::| |.|  :.:..|...:..||    .|.|| .:.:||::..  ||.|...|.....|
 Worm     5 ILTSILVSL-VSFIIYVILARKERFRLRGKIGLSGPEP-HWLMGNLKQIIERKAKLGYDDSYDWY 67

  Fly    61 EKF-KGNGAPFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRG----MYHNERDDPLTGHLFR 120
            .|. |..|..| |.:...:..:.:|:.|..|::.|::|:||.||.    :..|:..:.|..:.:.
 Worm    68 NKLHKQFGETF-GIYFGTQLNINITNEEDIKEVFIKNFSNFSDRTPPPIIEDNKLKESLLQNTYE 131

  Fly   121 IDGPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCGILEIGDLMARYTSDV 185
               ..|:..|..::|.|::.|||.|..|:....:...::..|.|.:..  ..:|.|.....|.||
 Worm   132 ---SGWKHTRSAIAPIFSTGKMKAMHETIHSKVDLFLEILKEKASSGQ--KWDIYDDFQGLTLDV 191

  Fly   186 IGRCAFGVECNGLRNPEAEFAIMGRRAFS--ERRHCKLVD-GFIESFPEVARFLRMRQIHQDITD 247
            ||:|||.::.|..|:....|.:..|:..:  :.||.|::. .|:  |||:::..::.....|:..
 Worm   192 IGKCAFAIDSNCQRDRNDVFYVNARKFITNIDIRHSKIISTSFL--FPELSKLWKVLYRFTDLAK 254

  Fly   248 FYVGIVRETV----KQREEQGIVRSDFMNLLI--EMKQRGELTIEEMAAQAFIFFAAGFDTSAST 306
            ..:.:|....    ::|..:|....|.:.||:  |..:...:|.:|:....|.|..||::|:::.
 Worm   255 AEIPLVEGLADVYERRRGGEGSDSVDLLKLLLNREDDKSKPMTKQEVIENCFAFLLAGYETTSTA 319

  Fly   307 LGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQELRYMELVIAETLRKYPILPQLTRIS 371
            :.:..|.|:|.|.:|.||.|||.:|  ..||..||||:..::|::.|..||||.||  |.:...:
 Worm   320 MTYCSYLLSKYPNVQQKLYEEIMEA--KENGGLTYDSIHNMKYLDYVYKETLRCYP--PVIHFSN 380

  Fly   372 RHL---YAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRPTA-AWLPF 432
            |..   ...:|  .||.:...::.:| :.:|.:|..:..|.:|.||||  :...::.:: .|:||
 Worm   381 RRCLKDITIRG--QFYPKGAIVVCLP-HTVHRNPENWDSPEEFHPERF--ENWEEKSSSLKWIPF 440

  Fly   433 GDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKIEFLKSNILLCPANGIYLK 490
            |.|||.|:||||.:|:....:..||..|...         :|.....|:...||:.::
 Worm   441 GVGPRYCVGMRFAEMEFKTTIAKLLDTFELK---------QFEGEADLIPDCNGVIMR 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 130/477 (27%)
cyp-25A3NP_001040850.1 p450 37..496 CDD:278495 132/481 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T98081
orthoMCL 1 0.900 OOG5_126554
Panther 1 1.100 O PTHR24292
Phylome 1 0.910 0.812 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.