DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and Cyp6d2

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_611698.1 Gene:Cyp6d2 FlyBaseID:FBgn0034756 Length:512 Species:Drosophila melanogaster

Alignment Length:503 Identity:169/504 (34%)
Similarity:280/504 (56%) Gaps:35/504 (7%)


  Fly     7 LLLIALAVG--FWFVRTRYSYWTRRGIGSEPARFPVGNMEGFRKNKHFIDI-VTPIYEKFKGNGA 68
            :||..|..|  :.:|:..|::|.|.|:..|||:.|.|.|:...|.:..:.: :..||.:.:|.  
  Fly     4 ILLTILIAGLLYRYVKRHYTHWQRLGVDEEPAKIPFGVMDTVMKQERSLGMALADIYARHEGK-- 66

  Fly    69 PFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLTGHLFRIDGPKWRPLRQKM 133
             ..|.:|:.:..:|:.|.:||:||:..|||:|.|||:|.:|..|||:.:||.:.|..||.||||:
  Fly    67 -IVGIYMLNKRSILIRDAQLARQIMTSDFASFHDRGVYVDEDKDPLSANLFNLRGASWRNLRQKL 130

  Fly   134 SPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCGILEIGDLMARYTSDVIGRCAFGVECNGL 198
            :|:|:|.|:|.||.|:.:||::|.|......|.:  ..:||.|:|..|..|:||...||:|.:..
  Fly   131 TPSFSSGKIKGMFGTIDDVGDKLVQHLEGALDQS--DEVEIKDVMTTYAVDIIGSVIFGLEIDSF 193

  Fly   199 RNPEAEF-AIMGRRAFSERRHCKLVDGFIESFPEVARFLRMRQIHQDITDFYVGIVRETVKQREE 262
            |||:.|| .|....:..|....|:.:..:...|.:|:.:........|......:::.|::.|||
  Fly   194 RNPKNEFREISSSTSRDESLLLKIHNMSMFICPPIAKLMNRLGYESRILTSLRDMMKRTIEFREE 258

  Fly   263 QGIVRSDFMNLLIEMKQRGE--------------------LTIEEMAAQAFIFFAAGFDTSASTL 307
            ..:||.|.:.|||.::..|:                    ::||::|||||:|:.||.:::|:..
  Fly   259 HNVVRKDMLQLLIRLRNTGKIGEDDDQVWDMETAQEQLKSMSIEKIAAQAFLFYVAGSESTAAAS 323

  Fly   308 GFALYELAKQPALQAKLREEIDQALRLHN----GEFTYDSMQELRYMELVIAETLRKYPILPQLT 368
            .|.||||:..|.|..:.:||:|..|..||    ..|||:::|:|:::::.|.||:||||.||.|.
  Fly   324 AFTLYELSMYPELLKEAQEEVDAVLMKHNLKPKDRFTYEAVQDLKFLDICIMETIRKYPGLPFLN 388

  Fly   369 RISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRPTAAWLPFG 433
            |.....|...|..|. |..|..:||.::|:..||..:|.|:.:.|.||.::.: ....||::|||
  Fly   389 RECTEDYPVPGTNHI-IAKGTPILISLFGMQRDPVYFPNPNGYDPHRFDSNNM-NYDQAAYMPFG 451

  Fly   434 DGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKIEFLKSNILL 481
            :|||:||.:|.||:.:.:.:..:|.||.....||.:.:..|..:.:|:
  Fly   452 EGPRHCIALRMGKVNSKVAVAKILANFDLVQSPRKEVEFRFDAAPVLV 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 159/474 (34%)
Cyp6d2NP_611698.1 p450 65..506 CDD:278495 151/443 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51409
eggNOG 1 0.900 E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I2561
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24292
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.