DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and Cyp317a1

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001286435.1 Gene:Cyp317a1 FlyBaseID:FBgn0033982 Length:518 Species:Drosophila melanogaster

Alignment Length:490 Identity:158/491 (32%)
Similarity:264/491 (54%) Gaps:33/491 (7%)


  Fly     4 VVALLLIALAVGFWFVRTRY--SYWTRRGIGSEPAR--FPV--------GNMEGFRKNKHFIDIV 56
            ::.||::.|.| ...:..||  .||....|..|..:  :|:        .:.|.. |.:|:    
  Fly     7 IIGLLVLGLLV-LLIIAARYQRDYWRYLDIPHERPKKLWPIIRQIMTQTLSTEAM-KAEHY---- 65

  Fly    57 TPIYEKFKGNGAPFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLTGHLFRI 121
            :.||:||||:| ||.||:.:|:|..|:.|.||.:||:|:||.||.|||:|.|::.|||:|.|:.:
  Fly    66 SAIYKKFKGSG-PFCGFYALLQPRALILDRELIRQIMIKDFWNFNDRGLYCNQKSDPLSGDLYAL 129

  Fly   122 DGPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCGILEIGDLMARYTSDVI 186
            .|..|:.:|||:.|:....:|..::..:.|..|:|.........:.....:.|..:|.||....:
  Fly   130 RGESWKEMRQKLDPSLEGDRMSLLYDCLYEEAEQLLLTVNSTLMSQPHSTVHIQKIMRRYVLSSL 194

  Fly   187 GRCAFGVECNGLRN-PEAEFAIMGRRAFSERRHCKLVDGFIESFPEVARFLRMRQIHQDITDFYV 250
            .:|.||:.....:. |..:|..|...|.:..:|..|::..:..||...|.||||:..:...::::
  Fly   195 AKCVFGLNAEQRKTYPLEDFEQMTELALNSHKHGYLMNLMMIRFPNFCRMLRMRRTPKQAEEYFI 259

  Fly   251 GIVRETVKQREEQGIVRSDFMNLLIEM-------------KQRGELTIEEMAAQAFIFFAAGFDT 302
            .::...|:|||..|..:.|::.|||::             |:.|.....|:||.|.:|..||::.
  Fly   260 KLLTSIVEQRETSGKPQKDYLQLLIDVKALEFITHQYEADKELGAHLQNELAAHAVVFLKAGYEQ 324

  Fly   303 SASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQELRYMELVIAETLRKYPILPQL 367
            :|:||.:.|||||..|.||.::|||:.:|:..|:|..|::.::.|.:|..||.||||.:||.|.:
  Fly   325 TANTLSYVLYELALHPELQVRVREEVKKAIERHDGHITHEGIKSLSFMGQVINETLRMHPITPYI 389

  Fly   368 TRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRPTAAWLPF 432
            .|.:.:.||......:.:.....|:||.:.|||||.:||:|.:|.|:|:...:.:.:....|..|
  Fly   390 LRRTLNDYAVPDHPKYILVKELFLIIPTHAIHHDPDIYPDPEEFKPDRWSGPRDSLQEQGTWFGF 454

  Fly   433 GDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPR 467
            |.|.|:|||::|.::|..:.|..||..:.||:..|
  Fly   455 GVGARSCIGIQFAQLQLRLALALLLSEYEFSLNTR 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 148/458 (32%)
Cyp317a1NP_001286435.1 p450 39..466 CDD:299894 140/433 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5001987
eggNOG 1 0.900 E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1576
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24292
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.