DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and Cyp6a23

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster

Alignment Length:503 Identity:239/504 (47%)
Similarity:336/504 (67%) Gaps:11/504 (2%)


  Fly     1 MLDVVALLLIALAVGFWFVRTRYSYWTRRGIGSEPARFPVGNMEGFRKNKHFIDIVTPIYEKFKG 65
            :|.::|||:..|   .:..|.|:.||.||||..:......|||:.:.|.:|...|....|.|:|.
  Fly     4 LLTLIALLVSLL---LFMARRRHGYWQRRGIPHDVPHPIYGNMKDWPKKRHIAMIFRDYYTKYKR 65

  Fly    66 NGAPFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLTGHLFRIDGPKWRPLR 130
            :..|||||:.......::|||||.|::||:||.:||:||:::||.||||:..||.|:|.|||.||
  Fly    66 SVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDDPLSATLFSIEGQKWRHLR 130

  Fly   131 QKMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCGILEIGDLMARYTSDVIGRCAFGVEC 195
            .|::|||||.|||.|||.:.:||||:.::...........:|||.||:||||:||||.||||:.|
  Fly   131 HKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQVLEIVDLVARYTADVIGNCAFGLNC 195

  Fly   196 NGLRNPEAEFAIMGRRAFSERRHCKLVDGFIESFPEVARFLRMRQIHQDITDFYVGIVRETVKQR 260
            |.|:||.|||..:|:||..|||:..|:|..|..||:::|.||::...||:.|||..|||.|:..|
  Fly   196 NSLQNPNAEFVTIGKRAIIERRYGGLLDFLIFGFPKLSRRLRLKLNVQDVEDFYTSIVRNTIDYR 260

  Fly   261 EEQGIVRSDFMNLLIEMKQRGE-------LTIEEMAAQAFIFFAAGFDTSASTLGFALYELAKQP 318
            ......|.|||:.||||.::.:       |:..|:.|||||||.|||:||::|:||||||||...
  Fly   261 LRTNEKRHDFMDSLIEMYEKEQAGNTEDGLSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQ 325

  Fly   319 ALQAKLREEIDQALRLHNGEFTYDSMQELRYMELVIAETLRKYPILPQLTRISRHLYAAKGDRHF 383
            .:|.:||.||:..|..||.||||:.::|::|:|.|:.|||||||:|..|||:::..::.: |..:
  Fly   326 DIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPE-DPKY 389

  Fly   384 YIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRPTAAWLPFGDGPRNCIGMRFGKMQ 448
            :|..|..::||..|||:||.:||||.||.||||..:.:|.||:..|||||:|||||||:|||.||
  Fly   390 FIAKGTTVVIPALGIHYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLMQ 454

  Fly   449 TTIGLVSLLRNFHFSVCPRTDPKIEFLKSNILLCPANGIYLKVQQLSQ 496
            ..:||..|:|.:.|||...|...::|:..:|||...|||:|||::||:
  Fly   455 ACVGLAYLIRGYKFSVSTETQIPMKFVVKSILLSAENGIHLKVEKLSK 502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 223/463 (48%)
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 221/460 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5001763
eggNOG 1 0.900 E2759_KOG0158
Homologene 1 1.000 H130979
Inparanoid 1 1.050 161 1.000 Inparanoid score I1576
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 1 1.100 P PTHR24292
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.