DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and Cyp4p3

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_610473.1 Gene:Cyp4p3 FlyBaseID:FBgn0033397 Length:515 Species:Drosophila melanogaster

Alignment Length:452 Identity:111/453 (25%)
Similarity:192/453 (42%) Gaps:79/453 (17%)


  Fly    83 VTDLELAKQILIQDFANFEDRGMYHNERDDPLTGHLFRIDGPKWRPLRQKMSPTF---TSAKMKY 144
            |.|.:.|:::|  :..|..::|..::.....|...|....|.||...|:.:||||   ...:.:.
  Fly    96 VIDADSAERVL--NDPNLINKGTIYDFLHPFLRTGLLTSTGKKWHARRKMLSPTFHFNILNQFQE 158

  Fly   145 MFPTVCEVGEELTQVCGELADNAMCGILEIGDLMARYTSDVIGRCAFGV---------------- 193
            :|  :.|..:.|.|..|.  |.|   |:.:.:::.|:|.:.|...|.||                
  Fly   159 IF--ITESLKFLEQFKGN--DEA---IISLNEVIPRFTLNSICETAMGVKLDEMAEKGDRYRENF 216

  Fly   194 ----EC--NGLRNP----EAEFAIMGRRAFSERRHCKLVDGFIESFPEVARFLRMRQIHQDITDF 248
                ||  ..:.||    :..|     :.|:|:.:...:| .:..|.......|..|::.:|.. 
  Fly   217 RQIEECFIRRMSNPLLWSDTLF-----KMFAEKDYASALD-VVHGFSSEIIAKRRDQLNDEIDS- 274

  Fly   249 YVGIVRETVKQREEQGIV---RSDFMNLLIEMKQRGELTIEEMAAQAFIFFAAGFDTSASTLGFA 310
                 |...:..|::...   |...::.||..::.|.:....:..:.......|:||::..|.|.
  Fly   275 -----RGNTQTAEDELFTSKKRFAMLDTLILAEKDGLIDHIGICEEVDTLMFEGYDTTSIGLMFG 334

  Fly   311 LYELAKQPALQAKLREE----IDQALRLHNGEFTYDSMQELRYMELVIAETLRKYPILPQL---- 367
            |..::..|..|.|..:|    ||..|.:.|    ...:.:|:.:|..|.||:|.:|.:|.:    
  Fly   335 LMNMSLYPEEQEKCYQEIQANIDDELNILN----IGQLNKLKNLEYFIKETMRLFPSVPAMGRET 395

  Fly   368 ---TRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRPTAAW 429
               |.:|..|...||.:.|         :.|:.||.:|..:..|.:|.|||||.:....|.|.|:
  Fly   396 TRETELSNGLILPKGSQIF---------VHVFDIHRNPEYWDSPEEFRPERFLPENSQNRHTYAY 451

  Fly   430 LPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKIEFLKSNILLCPANGIYLKV 491
            :||..|.|||||.:|...:....:|:||:  .|.:.|..|||....::.:.|...|.|::|:
  Fly   452 IPFSAGQRNCIGQKFAMQEMKTLMVALLK--QFQILPEIDPKTIVFQTGLTLRTKNQIHVKL 511

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 111/451 (25%)
Cyp4p3NP_610473.1 p450 54..505 CDD:278495 108/445 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.