DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and Cyp4ad1

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_610380.1 Gene:Cyp4ad1 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster

Alignment Length:542 Identity:118/543 (22%)
Similarity:204/543 (38%) Gaps:148/543 (27%)


  Fly    51 HFIDIVTPIYEKFKG-NGAPFAG--FFMMLRPVVLVTDLELAKQIL----IQDFANFEDRGM--- 105
            ::||.:..|.|...| ...||.|  |...|:|.      |..|::|    ..||..|  |.:   
  Fly    23 NYIDHMAGIMEMIPGPTPYPFVGNLFQFGLKPA------EYPKKVLQYCRKYDFQGF--RSLVFL 79

  Fly   106 -YHNERDDP-------------LTGHLFRI------------DGPKWRPLRQKMSPTFTSAKMKY 144
             ||....||             ...||:..            .|.:|...::..:|.|..:.::.
  Fly    80 QYHMMLSDPAEIQNILSSSSLLYKEHLYSFLRPWLGDGLLTSSGARWLKHQKLYAPAFERSAIEG 144

  Fly   145 MFPTVCEVGEELTQVCGELADNAMCGILEIGDLMARYTSDVIGRCAFGVECNGLRNPEAEF---- 205
            ....|...|.:..|....|:|..  .:.:..:|:|:.|.|::...|.|.:.:.|....::.    
  Fly   145 YLRVVHRTGGQFVQKLDVLSDTQ--EVFDAQELVAKCTLDIVCENATGQDSSSLNGETSDLHGAI 207

  Fly   206 ----AIMGRRAFSERRHCKLVDGFIESFPEVARFLRMRQIHQDITDFYVGIVRETVKQREEQGIV 266
                .::..|.||          .::.|..:.|          :|.:|       :|||....::
  Fly   208 KDLCDVVQERTFS----------IVKRFDALFR----------LTSYY-------MKQRRALSLL 245

  Fly   267 RSD---------------------------FMNLLIEMKQRGELTIE-EMAAQAFIFFAAGFDTS 303
            ||:                           |:::|:..|..|::..| |:..:...|...|.|..
  Fly   246 RSELNRIISQRRHQLAAENTCQQGQPINKPFLDVLLTAKLDGKVLKEREIIEEVSTFIFTGHDPI 310

  Fly   304 ASTLGFALYELAKQPALQAKLREEIDQALRLHN--GEFTYDSMQELRYMELVIAETLRKYPILPQ 366
            |:.:.|.||.|::...:|.|..|| .:.:...|  ||.....:.::.|:||:|.||||.||.:|.
  Fly   311 AAAISFTLYTLSRHSEIQQKAAEE-QRRIFGENFAGEADLARLDQMHYLELIIRETLRLYPSVPL 374

  Fly   367 LTRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRPTA---- 427
            :.|.:|:.....|.:   :.....:::.:..:.::...:.:|..|.||||      :.||.    
  Fly   375 IARTNRNPIDINGTK---VAKCTTVIMCLIAMGYNEKYFDDPCTFRPERF------ENPTGNVGI 430

  Fly   428 ---AWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTD---------------PKIEF 474
               ..:||..|||.||..:|...|....|..|||  .|.:.|..|               |:.|:
  Fly   431 EAFKSVPFSAGPRRCIAEKFAMYQMKALLSQLLR--RFEILPAVDGLPPGINDHSREDCVPQSEY 493

  Fly   475 ---LKSNILLCPANGIYLKVQQ 493
               |...:.|...|||.:::::
  Fly   494 DPVLNIRVTLKSENGIQIRLRK 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 118/539 (22%)
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 105/483 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.