DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and Cyp4a3

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_786936.1 Gene:Cyp4a3 RGDID:631356 Length:507 Species:Rattus norvegicus

Alignment Length:544 Identity:130/545 (24%)
Similarity:232/545 (43%) Gaps:114/545 (21%)


  Fly     4 VVALLLIALAVGFWFVRTRYSYWTRRGIGSEPARFPVGNMEGFRKNKHFIDIVTPIYEKFKG--- 65
            :::|.|:......:::|.::.........|.|:.:..|:   ..|::.|..::|.: |||.|   
  Rat    24 LLSLFLVLFKAVQFYLRRQWLLKALEKFPSTPSHWLWGH---DLKDREFQQVLTWV-EKFPGACL 84

  Fly    66 ---NGAPFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLTGHLFR------- 120
               :|:         :..||:.|.:..|.:|               .|.||....:::       
  Rat    85 QWLSGS---------KTRVLLYDPDYVKVVL---------------GRSDPKASGIYQFLAPWIG 125

  Fly   121 -----IDGPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCGILEIGDLMAR 180
                 ::|.||...|:.::|.|....:|.....:.:....:.....:|.|..  ..|||...::.
  Rat   126 YGLLLLNGKKWFQHRRMLTPAFHYGILKPYVKIMADSVNIMLDKWEKLDDQD--HPLEIFHYVSL 188

  Fly   181 YTSDVIGRCAFG------------------VECNGLRNPEAEFAIMGRRAF--------SERRHC 219
            .|.|.:.:|||.                  .:.|.|.......|..|....        ..||.|
  Rat   189 MTLDTVMKCAFSHQGSVQLDVNSRSYTKAVEDLNNLTFFRVRSAFYGNSIIYNMSSDGRLSRRAC 253

  Fly   220 KL----VDGFIESFPEVARFLRMRQIHQDITDFYVGIVRETVKQREEQGIVRSDFMNLLI--EMK 278
            ::    .||.|:        :|..|:..:         .|..|.|:::.:   ||:::|:  :|:
  Rat   254 QIAHEHTDGVIK--------MRKAQLQNE---------EELQKARKKRHL---DFLDILLFAKME 298

  Fly   279 QRGELTIEEMAAQAFIFFAAGFDTSASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDS 343
            ....|:.|::.|:...|...|.||:||.:.:..|.||..|..|.:.|||: |::.......|:|.
  Rat   299 DGKSLSDEDLRAEVDTFMFEGHDTTASGISWVFYALATHPEHQERCREEV-QSILGDGTSVTWDH 362

  Fly   344 MQELRYMELVIAETLRKYPILPQLTR-ISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPE 407
            :.::.|..:.|.|.||.||.:|.::| :|..:....|..   |..|....|.:||:||:|:.:|.
  Rat   363 LDQIPYTTMCIKEALRLYPPVPSVSRELSSPVTFPDGRS---IPKGITTTILIYGLHHNPSYWPN 424

  Fly   408 PHKFIPERFLADQLAQRPTAAWLPFGDGPRNCIGMRFGKMQTTIGL-VSLLRNFHFSVCPRTDP- 470
            |..|.|.||..|  :.|.:.|:|||..|.|||||.:|...:..:.: ::|||   |.:.|  || 
  Rat   425 PKVFDPSRFSPD--SPRHSHAYLPFSGGARNCIGKQFAMNELKVAVALTLLR---FELLP--DPT 482

  Fly   471 KIEFLKSNILLCPANGIYLKVQQL 494
            :|....:.::|...|||:|::::|
  Rat   483 RIPVPMARLVLKSKNGIHLRLKKL 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 125/509 (25%)
Cyp4a3NP_786936.1 p450 52..502 CDD:278495 126/511 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.