DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and Cyp3a23/3a1

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_037237.2 Gene:Cyp3a23/3a1 RGDID:628626 Length:502 Species:Rattus norvegicus

Alignment Length:514 Identity:151/515 (29%)
Similarity:247/515 (48%) Gaps:54/515 (10%)


  Fly     2 LDVVALLLIALAVGFWFVRTRYSYWTRRGI-GSEPARFPVGNMEGFRKNKHFIDIVTPIYEKFKG 65
            |:...||.:.|.:.:.|....:..:.::|| |.:|..| .|.:..:.......|:  ..::|:  
  Rat     9 LETWVLLAVVLVLLYGFGTRTHGLFKKQGIPGPKPLPF-FGTVLNYYMGLWKFDV--ECHKKY-- 68

  Fly    66 NGAPFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLTGHLFRI----DGPKW 126
              ....|.|....|:..:||.|:.|.:|::     |...::.|.||....|.:.:.    ...:|
  Rat    69 --GKIWGLFDGQMPLFAITDTEMIKNVLVK-----ECFSVFTNRRDFGPVGIMGKAISVSKDEEW 126

  Fly   127 RPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCGILEIGDLMARYTSDVIGRCAF 191
            :..|..:||||||.::|.|||.:.:.|:.|.:...:.....    :.:.::...|:.|||...:|
  Rat   127 KRYRALLSPTFTSGRLKEMFPVIEQYGDILVKYLRQEKGKP----VPVKEVFGAYSMDVITSTSF 187

  Fly   192 GVECNGLRNPEAEFAIMGRRAFSERRHCKLVDGFIESFPEVARF---------LRMRQIHQDITD 247
            ||..:.|.||:..|....::...       :|.|...|..|..|         |.:....:|..:
  Rat   188 GVNVDSLNNPKDPFVEKAKKLLR-------IDFFDPLFLSVVLFPFLTPVYEMLNICMFPKDSIE 245

  Fly   248 FYVGIV---RETVKQREEQGIVRSDFMNLLI-------EMKQRGELTIEEMAAQAFIFFAAGFDT 302
            |:...|   :||.....::.  |.||:.|::       :.:....|:..|:.||:.||..||::.
  Rat   246 FFKKFVYRMKETRLDSVQKH--RVDFLQLMMNAHNDSKDKESHTALSDMEITAQSIIFIFAGYEP 308

  Fly   303 SASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQELRYMELVIAETLRKYPILPQL 367
            ::|||.|.|:.||..|..|.||:||||:||. :....|||::.|:.|:::|:.||||.|||..:|
  Rat   309 TSSTLSFVLHSLATHPDTQKKLQEEIDRALP-NKAPPTYDTVMEMEYLDMVLNETLRLYPIGNRL 372

  Fly   368 TRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRPTAAWLPF 432
            .|:.:......|   .::..|.:::||.|.:|.||..:|||.:|.||||..:.........:|||
  Rat   373 ERVCKKDVEING---VFMPKGSVVMIPSYALHRDPQHWPEPEEFRPERFSKENKGSIDPYVYLPF 434

  Fly   433 GDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKIEFLKSNILLCPANGIYLKV 491
            |:||||||||||..|...:.|..:|:||.|..|..|...::..:.. ||.|...|.|||
  Rat   435 GNGPRNCIGMRFALMNMKLALTKVLQNFSFQPCKETQIPLKLSRQG-LLQPTKPIILKV 492

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 142/479 (30%)
Cyp3a23/3a1NP_037237.2 p450 39..492 CDD:278495 143/483 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T131170
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.