DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and Cyp3a18

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_665725.1 Gene:Cyp3a18 RGDID:628709 Length:497 Species:Rattus norvegicus

Alignment Length:521 Identity:148/522 (28%)
Similarity:254/522 (49%) Gaps:65/522 (12%)


  Fly     2 LDVVALLLIALAVGFWFVRTRYSYWTRRGIGSEPARFPV---GNMEGFRKNKHFIDIVTPIYEKF 63
            |.:...:|:|.::..:::...||:...:.:|. |...||   |.:..:.......|  ...|:|:
  Rat     7 LSIETWVLLATSLMLFYIYGTYSHGLFKKLGI-PGPKPVPLFGTIFNYGDGMWKFD--DDCYKKY 68

  Fly    64 KGNGAPFAGFFMMLRPVVLVTDLELAKQILIQD-FANFEDRGMYHNERDDPLTGHLFRIDGP--- 124
                ....||:...:|.:.:.|.|:.|.:|::: ::.|.:|                |..||   
  Rat    69 ----GKIWGFYEGPQPFLAIMDPEIIKMVLVKECYSVFTNR----------------RCFGPMGF 113

  Fly   125 -----------KWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCGILEIGDLM 178
                       :|:.||..:||||||.|:|.|||.:.:.|:.|.:  ....:.|....:.:.|:.
  Rat   114 MKKAITMSEDEEWKRLRTILSPTFTSGKLKEMFPLMRQYGDTLLK--NLRREEAKGEPINMKDIF 176

  Fly   179 ARYTSDVIGRCAFGVECNGLRNPEAEFAIMGRRAFSERRHCKLVDGFIES---FP---EVARFLR 237
            ..|:.|||...:|||..:.|.||:..|....::...    .::.|.|:.|   ||   .:...|.
  Rat   177 GAYSMDVITGTSFGVNVDSLNNPQDPFVQKAKKILK----FQIFDPFLLSVVLFPFLTPIYEMLN 237

  Fly   238 MRQIHQDITDFYVGIVRETVKQR-EEQGIVRSDFMNLLIE-MKQRGE-----LTIEEMAAQAFIF 295
            .....:...:|:...|:...|.| :.....|.||:.|::. ...:|:     |:..||||||.||
  Rat   238 FSIFPRQSMNFFKKFVKTMKKNRLDSNQKNRVDFLQLMMNTQNSKGQESQKALSDLEMAAQAIIF 302

  Fly   296 FAAGFDTSASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQELRYMELVIAETLRK 360
            ...|:|.:::::.|.:||||.:|.:|.||:.|||:||. :....|||::.|:.|:::|:.|:||.
  Rat   303 IFGGYDATSTSISFIMYELATRPNVQKKLQNEIDRALP-NKAPVTYDALMEMEYLDMVVNESLRL 366

  Fly   361 YPILPQLTRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRP 425
            |||..:|.|:|:......|   .:|..|.::.||:|.:|.:|..:.||.:|.||||..:......
  Rat   367 YPIATRLDRVSKKDVEING---VFIPKGTVVTIPIYPLHRNPEYWLEPEEFNPERFSKENKGSID 428

  Fly   426 TAAWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKIEFLKSNILLCPANGIYLK 490
            ...:||||:||||||||||..:...:.::.:|:||:...|.:|...::..:..|.. |...|.||
  Rat   429 PYVYLPFGNGPRNCIGMRFALISMKLAVIGVLQNFNIQPCEKTQIPLKISRQPIFQ-PEGPIILK 492

  Fly   491 V 491
            :
  Rat   493 L 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 142/487 (29%)
Cyp3a18NP_665725.1 p450 39..493 CDD:278495 142/487 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T131170
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.