DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and Tbxas1

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_035669.3 Gene:Tbxas1 MGIID:98497 Length:533 Species:Mus musculus

Alignment Length:539 Identity:152/540 (28%)
Similarity:248/540 (46%) Gaps:78/540 (14%)


  Fly     5 VALLLIALAVGFWFVRTRYSYWTRRGI-GSEPARFPVGNMEGFRKNKHFIDIVTPIYEKFKGNGA 68
            |.||:..||:..|:..:.:|...:.|| ..:|:.| |||:..||:.  |.:....:.|::    .
Mouse    18 VTLLVALLALLKWYSMSAFSRLEKLGIRHPKPSPF-VGNLMFFRQG--FWESQLELRERY----G 75

  Fly    69 PFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLTGHLFRIDGPKWRPLRQKM 133
            |..|:::..|..|::::.::.||:|:::|:||.:| |........:...:..:...:|..:|..:
Mouse    76 PLCGYYLGRRMHVVISEPDMIKQVLVENFSNFSNR-MASGLEPKMVADSVLLLRDRRWEEVRGAL 139

  Fly   134 SPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCGILEIGDLMARYTSDVIGRCAFGVECNGL 198
            ..:|:..|:..|.|.:.:..|.|.......|  |......|......||.||:...|||.:.:..
Mouse   140 MSSFSPEKLDEMTPLISQACELLVAHLKRYA--ASRDAFNIQRCYCCYTIDVVASVAFGTQVDSQ 202

  Fly   199 RNPEAEFAIMGRRAFSERRHCKLVDGF---------IESFPEV----ARFLRMRQIHQDITDFYV 250
            .:||..|.          :||:....|         |.|||.:    ||.|..:. ..::..|:.
Mouse   203 NSPEDPFV----------QHCRRASTFCIPRPLLVLILSFPSIMVPLARILPNKN-RDELNGFFN 256

  Fly   251 GIVRETVKQREEQGIV--RSDFMNLLI----------------------------EMKQR----- 280
            .::|..:..|::|...  |.||:.:::                            |..||     
Mouse   257 TLIRNVIALRDQQAAEERRRDFLQMVLDAQHSMNSVGVEGFDMVPESLSSSECTKEPPQRCHPTS 321

  Fly   281 --GELTIEEMAAQAFIFFAAGFDTSASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDS 343
              ...|::|:..|||:|..||.:...:||.|..|.||..|..|.:|.:|:|..:..|... .|.|
Mouse   322 TSKPFTVDEIVGQAFLFLIAGHEVITNTLSFITYLLATHPDCQERLLKEVDLFMGKHPAP-EYHS 385

  Fly   344 MQE-LRYMELVIAETLRKYPILPQLTRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPE 407
            :|| |.|:::||:||||.||...:.||.:.......|.|   |..|.:|.|.|..:||||..:|.
Mouse   386 LQEGLPYLDMVISETLRMYPPAFRFTREAAQDCEVLGQR---IPAGTVLEIAVGALHHDPEHWPN 447

  Fly   408 PHKFIPERFLADQLAQRPTAAWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKI 472
            |..|.||||.|:...||....:||||.|||:|:|:|.|.:...:.::.:|..|.|...|.|...:
Mouse   448 PETFDPERFTAEARLQRRPFTYLPFGAGPRSCLGVRLGLLVVKLTILQVLHKFRFEASPETQVPL 512

  Fly   473 EFLKSNILLCPANGIYLKV 491
            : |:|...|.|.||:|:|:
Mouse   513 Q-LESKSALGPKNGVYIKI 530

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 143/507 (28%)
Tbxas1NP_035669.3 p450 47..530 CDD:278495 143/509 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H130979
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.668 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.