DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and cyp-13A2

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_496109.1 Gene:cyp-13A2 WormBaseID:WBGene00011676 Length:515 Species:Caenorhabditis elegans

Alignment Length:530 Identity:149/531 (28%)
Similarity:228/531 (43%) Gaps:119/531 (22%)


  Fly     6 ALLLIALAVGFWFVRTRYSYWTRRGIGSEPARFPVGNMEGFRKNKHFIDIVTP----IYEKFKGN 66
            ::.|..|....|.    ::||.|:|:.....|..||.::...:::      ||    :.|..|..
 Worm    12 SIFLGILTYYLWI----WTYWMRKGVKGPRGRPFVGVLDVLLEHE------TPGLIKLGEWTKKY 66

  Fly    67 GAPFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLTG--------HLFRIDG 123
            |..: |:....:..::|.|..:..:|.::.|.||..|.:      :|:.|        ||....|
 Worm    67 GKVY-GYTDGTQRTLVVADPAMVHEIFVKQFDNFYGRKL------NPIQGNPEKEQRVHLLAAQG 124

  Fly   124 PKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQ------VCGELADNAMCGILEIGDLMAR-- 180
            .:|:.||...|.:|::|.:|.|..||.:...||.:      ..||..|            |.|  
 Worm   125 YRWKRLRTISSQSFSNASLKKMKRTVEDSALELLRHIEKQTAGGEQID------------MLRFY 177

  Fly   181 --YTSDVIGRCAFG-VECNGLRNPEAEFAIMGRRAF-SERRHCKLVDGFIESFPEVARFLR---- 237
              ||.|||||.|.| .:....:||.....   |..| ..|::..|:   .:.||.:.:|:|    
 Worm   178 QEYTMDVIGRFAMGQTDSMMFKNPIVNVV---REIFCGSRKNLMLI---CQVFPPIGQFIRDLTF 236

  Fly   238 ---------MRQIHQDITDFYVGIVRETVKQREEQGIVRS----DFMNLLIE------------- 276
                     :..|.||       :|...:.|||.:....|    ||::|.::             
 Worm   237 KFPRIPAFKLYSIMQD-------VVAARIAQREREKGAESGEPQDFIDLFLDARSDDVDFSAEAR 294

  Fly   277 -------MKQRGELTIEEMAAQAFIFFAAGFDTSASTLGFALYELAKQPALQAKLREEIDQALRL 334
                   :|...||:.:|:..|.|:|...||||:|.:|.:..|.||..|.:|.|:.|||  |...
 Worm   295 EDFSKRNLKITKELSADEVVGQCFLFLIGGFDTTALSLSYVTYLLAVNPKIQEKVIEEI--AREF 357

  Fly   335 HNGEFTYDSMQELRYMELVIAETLRKYPILPQLTRISRHLYAAK-----GDRHFYIEPGQMLLIP 394
            ...|..::.:..|:||:.||.|.||.||    |..||......|     |.:   ||.|..:.:.
 Worm   358 GTSEVEFEKLGRLKYMDCVIKEALRLYP----LASISNSRKCMKTTTVNGVK---IEAGVYVQMD 415

  Fly   395 VYGIHHDPALYPEPHK-FIPERFLADQLAQRPTAAWLPFGDGPRNCIGMRFGKMQTTIGLVSLLR 458
            .:.:|:||.|:.|..| |.|||:..|:..:. ..|:||||.|||.|||||...|:..|.|..||:
 Worm   416 TWSLHYDPELWGEDVKEFKPERWSTDEPLEH-KGAYLPFGLGPRQCIGMRLAIMEQKILLTHLLK 479

  Fly   459 NFHFSVCPRT 468
            |:.|....:|
 Worm   480 NYTFETGNKT 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 142/502 (28%)
cyp-13A2NP_496109.1 p450 35..511 CDD:278495 142/504 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I2561
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T97993
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.720 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.