DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and cyp-25A4

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_497779.1 Gene:cyp-25A4 WormBaseID:WBGene00007967 Length:501 Species:Caenorhabditis elegans

Alignment Length:528 Identity:142/529 (27%)
Similarity:245/529 (46%) Gaps:70/529 (13%)


  Fly     5 VALLLIALAVGFWFVRT--RYSYWTRR---------GIGSEPARFPVGNME---------GFRKN 49
            :|:|:|:..  |:.:.|  .||.|.|.         ||...|..:..||:.         |:...
 Worm     1 MAILIISTI--FFTIITFISYSIWRRHAIFKLRSSIGIPGPPVHWLWGNLNIIKDRVSRLGYNDT 63

  Fly    50 KHFIDIVTPIYEKFKGNGAPFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDR------GMYHN 108
            ..:...:...|       .|..|.:...:..:.|::.|..|:|.||:|:||.||      ||  |
 Worm    64 TQWHPTLHTKY-------GPIFGLYCGTQLHITVSEEEDIKEIFIQNFSNFSDRMTPDIFGM--N 119

  Fly   109 ERDDPLTGHLFRIDGPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCGILE 173
            :.:..|..:.:   ...|:..|..::|.|::.|||.|..|:....:...:|..|.:.:.     :
 Worm   120 QLNQSLLQNTY---ATGWKHTRSAIAPIFSTGKMKAMHETLVSKIDIFLEVLKEKSSSG-----Q 176

  Fly   174 IGDLMARYTS---DVIGRCAFGVECNGLRNPEAEFAIMGRR---AFSERRHCKLVDGFIESFPEV 232
            ..|:...:.|   |:||:|||.::.|..|:....|.:..|:   |...::...|....|  .||:
 Worm   177 KWDIFENFQSLSLDIIGKCAFAIDSNCQRDRTDLFYVQARKFVGAVDLKKSWILPVSLI--LPEL 239

  Fly   233 ARFLRMRQIHQDITDFYVGIVRETV-----KQREEQGIVRSDFMNLLIEMKQRGELTIEEMAAQA 292
            :...|......|::...:.:|:..|     ::..|.|...:|.:||||..:..|::|..|:....
 Worm   240 SWLWRFLYKFSDLSAAELPLVKGLVDLYDRRRAGEGGNDSTDLLNLLIRRETIGKMTQREVIENC 304

  Fly   293 FIFFAAGFDTSASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQELRYMELVIAET 357
            |.|..||::|:::.:.|:.|.||:.|.:|.||.|||.:.  ..|....|||:..::|::.|..|:
 Worm   305 FAFLIAGYETTSTAMMFSAYLLAEYPIVQQKLYEEIKKT--KENAGLNYDSIHNMKYLDCVYKES 367

  Fly   358 LRKYPILPQLT-RISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQL 421
            ||.||.....| |:..:....:|  ..|.|...:.:.| |.||.:||.:..|.:|.||||  :..
 Worm   368 LRFYPPTTHFTNRVCLNDMTIRG--QIYPEDSTLKVQP-YTIHRNPANWESPDEFQPERF--ENW 427

  Fly   422 AQRPTA-AWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKIEFLKSN-ILLCPA 484
            .::.:: .|:|||.|||.|:||||.:|:....:..||..|..|:.|...|.|.  ::| ::..|.
 Worm   428 EEKSSSLKWIPFGVGPRYCVGMRFAEMEFKTTIAKLLDTFELSLVPGDPPMIP--ETNGVIFRPR 490

  Fly   485 NGIYLKVQ 492
            :.:.|.::
 Worm   491 SPVRLNLK 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 131/485 (27%)
cyp-25A4NP_497779.1 p450 37..489 CDD:278495 129/480 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T98081
orthoMCL 1 0.900 OOG5_126554
Panther 1 1.100 O PTHR24292
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.