DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and CYP4A11

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_000769.2 Gene:CYP4A11 HGNCID:2642 Length:519 Species:Homo sapiens

Alignment Length:411 Identity:116/412 (28%)
Similarity:194/412 (47%) Gaps:55/412 (13%)


  Fly   113 PLTGH-LFRIDGPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCGI----- 171
            |..|: |..::|..|...|:.::|.|....:|   |.|           |.:||:....:     
Human   125 PWIGYGLLLLNGQTWFQHRRMLTPAFHYDILK---PYV-----------GLMADSVRVMLDKWEE 175

  Fly   172 -------LEIGDLMARYTSDVIGRCAFG------VECNGLRNPEAEFAIMGRRAFSERRHCKLVD 223
                   ||:...::..|.|.|.:|||.      |:.|.....:| .:.:....||..|:....:
Human   176 LLGQDSPLEVFQHVSLMTLDTIMKCAFSHQGSIQVDRNSQSYIQA-ISDLNNLVFSRVRNAFHQN 239

  Fly   224 GFIESFPEVARFL-RMRQIHQDITDFYVGIVR-ETVKQREEQGIVRS---DFMNLLI--EMKQRG 281
            ..|.|.....|:. |..|:....||..:.:.: :..|:.|.:.|.|.   ||:::|:  :|:...
Human   240 DTIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGS 304

  Fly   282 ELTIEEMAAQAFIFFAAGFDTSASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQE 346
            .|:.:::.|:...|...|.||:||.:.:.||.||..|..|.:.||||...|. .....|::.:.:
Human   305 ILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLG-DGASITWNHLDQ 368

  Fly   347 LRYMELVIAETLRKYPILPQLTR-ISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHK 410
            :.|..:.|.|.||.||.:|.:.| :|..:....|..   :..|.|:|:.:||:||:|.::|.|..
Human   369 MPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRS---LPKGIMVLLSIYGLHHNPKVWPNPEV 430

  Fly   411 FIPERFLADQLAQRPTAAWLPFGDGPRNCIGMRFGKMQTTIG-LVSLLRNFHFSVCPRTDP-KIE 473
            |.|.|| |...||. :.|:|||..|.|||||.:|...:..:. .::|||   |.:.|  || :|.
Human   431 FDPFRF-APGSAQH-SHAFLPFSGGSRNCIGKQFAMNELKVATALTLLR---FELLP--DPTRIP 488

  Fly   474 FLKSNILLCPANGIYLKVQQL 494
            ...:.::|...|||:|::::|
Human   489 IPIARLVLKSKNGIHLRLRRL 509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 115/407 (28%)
CYP4A11NP_000769.2 p450 52..505 CDD:278495 115/406 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.