DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and CYP1A1

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_000490.1 Gene:CYP1A1 HGNCID:2595 Length:512 Species:Homo sapiens

Alignment Length:554 Identity:134/555 (24%)
Similarity:220/555 (40%) Gaps:138/555 (25%)


  Fly     7 LLLIALAVGFWFVRTRYSYWTRRGIGSEPARFP---VGNMEGFRKNKHFIDIVTPIYEKFKGNGA 68
            |..:...:.||.:|..... ..:|:.:.|..:.   :|:|....||.|.  .::.:.:::     
Human    14 LASVIFCLVFWVIRASRPQ-VPKGLKNPPGPWGWPLIGHMLTLGKNPHL--ALSRMSQQY----- 70

  Fly    69 PFAGFFMMLR----PVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLTGHL--------FRI 121
               |..:.:|    |||:::.|:..:|.|::...:|:.       |.|..|..|        |..
Human    71 ---GDVLQIRIGSTPVVVLSGLDTIRQALVRQGDDFKG-------RPDLYTFTLISNGQSMSFSP 125

  Fly   122 D-GPKW---RPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCGILEIGDLMA--- 179
            | ||.|   |.|.|....:|:.|. .....|.|.:.|.:::....|       |..:.:|||   
Human   126 DSGPVWAARRRLAQNGLKSFSIAS-DPASSTSCYLEEHVSKEAEVL-------ISTLQELMAGPG 182

  Fly   180 -----RY----TSDVIGRCAFG----------VECNGLRNPEAEFAIMGRRAFSERRHCKLVDGF 225
                 ||    .::||....||          :....|.|...|....|..|             
Human   183 HFNPYRYVVVSVTNVICAICFGRRYDHNHQELLSLVNLNNNFGEVVGSGNPA------------- 234

  Fly   226 IESFPEVARFLRMRQIH--QDITDFYVGIVRETVKQRE---EQGIVRSDFMNLLIE---MKQRGE 282
              .|..:.|:|....::  :|:.:.:...:::.||:..   |:|.:| |..:.|||   .||..|
Human   235 --DFIPILRYLPNPSLNAFKDLNEKFYSFMQKMVKEHYKTFEKGHIR-DITDSLIEHCQEKQLDE 296

  Fly   283 -----LTIEEMAAQAFIFFAAGFDTSASTLGFALYELAKQPALQAKLREEIDQAL------RLHN 336
                 |:.|::.......|.|||||..:.:.::|..|...|.:|.|::||:|..:      ||  
Human   297 NANVQLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTVIGRSRRPRL-- 359

  Fly   337 GEFTYDSMQELRYMELVIAETLRKYPILP-----QLTRISRHLYAAKGDRHFYIEPGQMLLIPVY 396
                 .....|.|||..|.||.|....:|     ..||.:    :.||   |||..|:.:.:..:
Human   360 -----SDRSHLPYMEAFILETFRHSSFVPFTIPHSTTRDT----SLKG---FYIPKGRCVFVNQW 412

  Fly   397 GIHHDPALYPEPHKFIPERFLA-----DQLAQRPTAAWLPFGDGPRNCIGMRFGKMQTTIGLVSL 456
            .|:||..|:..|.:|:|||||.     |::.....   :.||.|.|.|||....:.:..:.|..|
Human   413 QINHDQKLWVNPSEFLPERFLTPDGAIDKVLSEKV---IIFGMGKRKCIGETIARWEVFLFLAIL 474

  Fly   457 LRNFHFSVCPRTDPKIEFLKSNILLCPANGIYLK 490
            |:...|||     |    |...:.:.|..|:.:|
Human   475 LQRVEFSV-----P----LGVKVDMTPIYGLTMK 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 129/527 (24%)
CYP1A1NP_000490.1 Mitochondrial targeting signal. {ECO:0000250|UniProtKB:P00185} 29..40 1/12 (8%)
p450 40..493 CDD:306555 127/520 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4074
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.