DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and Cyp3a16

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_031846.2 Gene:Cyp3a16 MGIID:106099 Length:504 Species:Mus musculus

Alignment Length:532 Identity:162/533 (30%)
Similarity:256/533 (48%) Gaps:88/533 (17%)


  Fly     2 LDVVALLLIALAVGFWFVRTRYSYWTRRGI-GSEPARFPVGNMEGFRKNKHFIDIVTPIYEKFKG 65
            ||.:.||.|.|.:.:.:....:..:.::|| |.:|..| :|.:..:.|.....|:  ..|||:..
Mouse     9 LDTLVLLAIILVLLYRYGTCTHGLFKKQGIPGPKPLPF-LGTVLNYYKGLWKFDM--ECYEKYGK 70

  Fly    66 NGAPFAGFFMMLRPVVLVTDLELAKQILIQD-FANFEDR------GMYHNE----RDDPLTGHLF 119
            ....|.|..    |:.::||.|..|.:|::: |:.|.:|      |:....    :|:       
Mouse    71 TWGLFDGQI----PLFVITDPETIKNVLVKECFSVFTNRQDFFPVGIMSKSISLAKDE------- 124

  Fly   120 RIDGPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCGILEIGDLMARYTSD 184
                 :|:..|..:||||||..:|.|||.:.:.|:.|.:...:.|:...  .:.:.|::..|:.|
Mouse   125 -----EWKRYRALLSPTFTSGNLKEMFPVIEQYGDILVKYLRQEAEKGK--PVAVKDVLGAYSMD 182

  Fly   185 VIGRCAFGVECNGLRNPEAEFAIMGRRAFSERRHCKLVDGFIESFPEVARF-------------- 235
            ||....|||..:.|.|||                    |.|:|:..:|.||              
Mouse   183 VIISTTFGVNIDSLNNPE--------------------DPFVENAKKVLRFDYFDPLSLSVALFP 227

  Fly   236 --------LRMRQIHQDITDFYVGIV-RETVKQREEQGIVRSDFMNLLIEMKQRGE-------LT 284
                    |.:....:|..:|:...| |.|..:.:.:...|.||:.|::|...:.:       |:
Mouse   228 FLTPIYEMLNICMFPKDSIEFFKKFVDRMTENRLDSKQKHRVDFIYLMMEAYNKSKDKDSHKALS 292

  Fly   285 IEEMAAQAFIFFAAGFDTSASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQELRY 349
            ..|:.||:.||..||::|::|.|.|.:|.||..|.:|.||:||||:||. :....|||::..:.|
Mouse   293 EIEITAQSIIFIFAGYETTSSILSFTVYSLATHPDIQKKLQEEIDEALP-NKAPPTYDTVMAMEY 356

  Fly   350 MELVIAETLRKYPILPQLTRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPE 414
            :::|:.||||.|||..:|.|:.:......|   .||..|..::||.|.:||||..:|||.:|.||
Mouse   357 LDMVLNETLRLYPITNRLQRVCKKDVEING---IYIPKGSTVIIPSYVLHHDPQHWPEPEEFQPE 418

  Fly   415 RFLADQLAQRPTAAWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKIEFLKSNI 479
            ||..:.........:||||:||||||||||..|...:.|:.:|:||.|..|..|...:: |...:
Mouse   419 RFSKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALIKVLQNFSFQPCKETQIPLK-LSREL 482

  Fly   480 LLCPANGIYLKV 491
            ||.|...|.|||
Mouse   483 LLQPVKPIVLKV 494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 152/497 (31%)
Cyp3a16NP_031846.2 p450 39..494 CDD:278495 153/501 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.