DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and LOC100910877

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:XP_003751175.1 Gene:LOC100910877 RGDID:6495986 Length:502 Species:Rattus norvegicus

Alignment Length:514 Identity:151/515 (29%)
Similarity:247/515 (48%) Gaps:54/515 (10%)


  Fly     2 LDVVALLLIALAVGFWFVRTRYSYWTRRGI-GSEPARFPVGNMEGFRKNKHFIDIVTPIYEKFKG 65
            |:...||.:.|.:.:.|....:..:.::|| |.:|..| .|.:..:.......|:  ..::|:  
  Rat     9 LETWVLLAVVLVLLYGFGTRTHGLFKKQGIPGPKPLPF-FGTVLNYYMGLWKFDV--ECHKKY-- 68

  Fly    66 NGAPFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLTGHLFRI----DGPKW 126
              ....|.|....|:..:||.|:.|.:|::     |...::.|.||....|.:.:.    ...:|
  Rat    69 --GKIWGLFDGQMPLFAITDTEMIKNVLVK-----ECFSVFTNRRDFGPVGIMGKAISVSKDEEW 126

  Fly   127 RPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCGILEIGDLMARYTSDVIGRCAF 191
            :..|..:||||||.::|.|||.:.:.|:.|.:...:.....    :.:.::...|:.|||...:|
  Rat   127 KRYRALLSPTFTSGRLKEMFPVIEQYGDILVKYLRQEKGKP----VPVKEVFGAYSMDVITSTSF 187

  Fly   192 GVECNGLRNPEAEFAIMGRRAFSERRHCKLVDGFIESFPEVARF---------LRMRQIHQDITD 247
            ||..:.|.||:..|....::...       :|.|...|..|..|         |.:....:|..:
  Rat   188 GVNVDSLNNPKDPFVEKAKKLLR-------IDFFDPLFLSVVLFPFLTPVYEMLNICMFPKDSIE 245

  Fly   248 FYVGIV---RETVKQREEQGIVRSDFMNLLI-------EMKQRGELTIEEMAAQAFIFFAAGFDT 302
            |:...|   :||.....::.  |.||:.|::       :.:....|:..|:.||:.||..||::.
  Rat   246 FFKKFVYRMKETRLDSVQKH--RVDFLQLMMNAHNDSKDKESHTALSDMEITAQSIIFIFAGYEP 308

  Fly   303 SASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQELRYMELVIAETLRKYPILPQL 367
            ::|||.|.|:.||..|..|.||:||||:||. :....|||::.|:.|:::|:.||||.|||..:|
  Rat   309 TSSTLSFVLHSLATHPDTQKKLQEEIDRALP-NKAPPTYDTVMEMEYLDMVLNETLRLYPIGNRL 372

  Fly   368 TRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRPTAAWLPF 432
            .|:.:......|   .::..|.:::||.|.:|.||..:|||.:|.||||..:.........:|||
  Rat   373 ERVCKKDVEING---VFMPKGSVVMIPSYALHRDPQHWPEPEEFRPERFSKENKGSIDPYVYLPF 434

  Fly   433 GDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKIEFLKSNILLCPANGIYLKV 491
            |:||||||||||..|...:.|..:|:||.|..|..|...::..:.. ||.|...|.|||
  Rat   435 GNGPRNCIGMRFALMNMKLALTKVLQNFSFQPCKETQIPLKLSRQG-LLQPTKPIILKV 492

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 142/479 (30%)
LOC100910877XP_003751175.1 p450 39..492 CDD:278495 143/483 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.