DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and tbxas1

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001164997.1 Gene:tbxas1 XenbaseID:XB-GENE-994325 Length:531 Species:Xenopus tropicalis

Alignment Length:558 Identity:163/559 (29%)
Similarity:262/559 (47%) Gaps:114/559 (20%)


  Fly     5 VALLLIA--LAVGFWFVRTRYSYWTRRGIGSEPARFP-VGNMEGFRK-----NKHFIDIVTPIYE 61
            |.|.|:|  |.:.:|:..:.:....:.|| ..|...| :||:..|:|     ::|.:....||  
 Frog    14 VTLTLVAGFLGLLYWYSVSAFWQLEKAGI-KHPKPLPFIGNIMLFQKGFWEGDRHLLKTYGPI-- 75

  Fly    62 KFKGNGAPFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLTGHLFRIDGPKW 126
                     .|::|..||::::.:.:..||:|.:||.||.:| |..|....|::..|..:...||
 Frog    76 ---------CGYYMGRRPMIVIAEPDAIKQVLQKDFVNFTNR-MRLNLVTKPMSDSLLCLRDDKW 130

  Fly   127 RPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAM--------CGILEIGDLMARYTS 183
            :.:|..::|:|::|:||.|.|.:       .|.|..|.:|.|        |.:..   ..|.:|.
 Frog   131 KRVRSVLTPSFSAARMKEMCPLI-------NQCCDVLVENLMEYASSGEACNVQR---CYACFTM 185

  Fly   184 DVIGRCAFGVECNGLRNPEAEFAIMGRRAFSERRHCKLVDGFIE-------------SFPE---- 231
            ||:...|||.:.:..|:.:....          ::||   .|:|             :||.    
 Frog   186 DVVASVAFGTQVDSQRDSDHPLV----------QNCK---RFLELFTPFKPVVLLCLAFPSIMIP 237

  Fly   232 VARFLRMRQIHQD-ITDFYVGIVRETVKQREEQ--GIVRSDFMNLLIEMK--------------- 278
            :||  |:...|:| |..|::.::|:.:..||.|  ...|.||:.|:::.:               
 Frog   238 IAR--RLPNKHRDRINSFFLKVIRDIIAFRENQPPNERRRDFLQLMLDARDSAGHVSVDHFDIVN 300

  Fly   279 ----------QRGE----------LTIEEMAAQAFIFFAAGFDTSASTLGFALYELAKQPALQAK 323
                      .||:          |..||:..|||||..||::|:.|.|.||.|.||..|..|.|
 Frog   301 QADLSVPQNQDRGQDPPRKSTQKTLNEEEILGQAFIFLIAGYETTCSLLSFASYLLATHPDCQEK 365

  Fly   324 LREEIDQALRLHNGEFTYDSMQELRYMELVIAETLRKYPILPQLTRISRHLYAAKGDRHFYIEPG 388
            |.:|:|:..:.|. |..|:::.:|.|||:||.||||.||...:..|.:.......|   ..|..|
 Frog   366 LLKEVDEFSQEHE-EADYNTVHDLPYMEMVINETLRMYPPAYRFAREAARDCTVMG---LGIPAG 426

  Fly   389 QMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRPTAAWLPFGDGPRNCIGMRFGKMQTTIGL 453
            .::.||:..:.:||..:.||.||.||||.|::..:|....:||||.|||:|||||...::..|.|
 Frog   427 AVVEIPIGCLQNDPRFWHEPEKFNPERFTAEEKQKRHPFLFLPFGAGPRSCIGMRLALLEAKITL 491

  Fly   454 VSLLRNFHFSVCPRTDPKIEFLKSNILLCPANGIYLKV 491
            ..:||.|.|..|..|...:: |.:...|.|.:|:|::|
 Frog   492 YRVLRKFRFQTCDLTQIPLQ-LSAMTTLRPKDGVYVRV 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 154/525 (29%)
tbxas1NP_001164997.1 p450 45..526 CDD:278495 154/523 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H130979
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.