DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a22 and Cyp3a59

Sequence 1:NP_001286431.1 Gene:Cyp6a22 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001098630.1 Gene:Cyp3a59 MGIID:3769707 Length:503 Species:Mus musculus

Alignment Length:521 Identity:142/522 (27%)
Similarity:258/522 (49%) Gaps:65/522 (12%)


  Fly     2 LDVVALLLIALAVGFWFVRTRYSYWTRRGIG-SEPARFPV-GNMEGFRKNKHFIDIVTPIYEKFK 64
            |.:...:|:..::.|:::...||:...:.:| ..|...|: |.:..:.......|  ...|:|: 
Mouse     7 LSIETWVLLVTSLVFFYIYGTYSHGLFKKLGIPGPKPLPLFGTIFNYFDGMWKFD--EDCYKKY- 68

  Fly    65 GNGAPFAGFFMMLRPVVLVTDLELAKQILIQD-FANFEDRGMYHNERDDPLTGHLFRI------- 121
               ....||::..:|::.:.|.|:.|.:|::: ::.|.:|         |..|.:..:       
Mouse    69 ---GKIWGFYVGPKPILAIMDPEIIKIVLVKECYSVFTNR---------PTLGPVGFLKKSITIS 121

  Fly   122 DGPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELT------QVCGELADNAMCGILEIGDLMAR 180
            :..:|:.||..:||||||.|:|.|||.:.:.|:.|.      :..||        .:.:.|:...
Mouse   122 EDEEWKRLRTLLSPTFTSGKLKEMFPIMRQYGDILVRNLRREEEKGE--------PINMKDIFGA 178

  Fly   181 YTSDVIGRCAFGVECNGLRNPEAEFAIMGRRAFSERRHCKLVDGFIES---FP---EVARFLRMR 239
            |:.|||...:|||..:.|.||:..|....::...    .|:.|.|:.|   ||   .:...|.:.
Mouse   179 YSMDVITGTSFGVNIDSLNNPQNPFVQKTKKILK----FKIFDPFLLSTILFPFLTPIYEMLNLS 239

  Fly   240 QIHQDITDFYVGIVRETVKQR---EEQGIVRSDFMNLLIE-MKQRGE-----LTIEEMAAQAFIF 295
            ...:|..:|:...|:...|:|   :::.  |.||:.|::. ...:|:     |:..||||||.||
Mouse   240 IFPRDSMNFFKKFVKRMKKERLASKQKN--RVDFLQLMMNTQNSKGQESQKALSDLEMAAQAVIF 302

  Fly   296 FAAGFDTSASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQELRYMELVIAETLRK 360
            ...|:|.:::::...:||||..|.:|.||::|||:.|. :....|||::.::.|:::|:.|:||.
Mouse   303 IFGGYDATSTSISLIMYELATHPDVQKKLQDEIDRTLP-NKAPVTYDALMDMEYLDMVVNESLRL 366

  Fly   361 YPILPQLTRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRP 425
            ||...:|.|:|:......|   .:|..|.:::||:|.:|.:|..:|||.:|.|.||..:......
Mouse   367 YPTAIRLERVSKKDVEING---VFIPKGTVVMIPIYPLHRNPEYWPEPQEFCPGRFSKENEGNID 428

  Fly   426 TAAWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKIEFLKSNILLCPANGIYLK 490
            ...::|||:|||||:.|||..:...:.::.:|:||....|..|...::..:..:.. |...|.||
Mouse   429 PYIYMPFGNGPRNCLDMRFALISMKLAVIGVLQNFTVQPCEETQIPLKISREPVFQ-PEKPIILK 492

  Fly   491 V 491
            |
Mouse   493 V 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 135/486 (28%)
Cyp3a59NP_001098630.1 p450 39..493 CDD:278495 135/488 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.