DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and CTNNAL1

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_003789.1 Gene:CTNNAL1 HGNCID:2512 Length:734 Species:Homo sapiens

Alignment Length:789 Identity:224/790 (28%)
Similarity:388/790 (49%) Gaps:121/790 (15%)


  Fly     7 STVNNQRFRVRDMDNEQIMSTFGNIGHLLNIAVERFITIGEIIAEENIDIKGDMYEAAKEARDAG 71
            :|:.|.:...:..|  :.:.....:|..:|:||.||:.:||.||.||.|:|.::..|..||:.||
Human    49 TTLINHKDNTKKSD--KTLQAIQRVGQAVNLAVGRFVKVGEAIANENWDLKEEINIACIEAKQAG 111

  Fly    72 KSIERLCDISPLSGMELRHHIEPLKDYGAIILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASE 136
            ::|..|.||:.|:.:|....|....|...:|.|||.||||||::|||.|.:|:|:::|::.:...
Human   112 ETIAALTDITNLNHLESDGQITIFTDKTGVIKAARLLLSSVTKVLLLADRVVIKQIITSRNKVLA 176

  Fly   137 SLEKLESVMNFTEFVRAFSVFGTEMIELAYLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTS 201
            ::|:||.|.:|.|||:.||.||.||:|.|:|:|..:|..|:|:::|:|.:||.:|||...:|||:
Human   177 TMERLEKVNSFQEFVQIFSQFGNEMVEFAHLSGDRQNDLKDEKKKAKMAAARAVLEKCTMMLLTA 241

  Fly   202 SKNSLIHSDCVIVKENRDTVFCQIRRAMDLIHFVVKDSIFDTAKHMPFEKQASNPNYENE----S 262
            ||..|.|.:|....:|::.||.:::.|:|.:..:|.|               ..||.|.:    |
Human   242 SKTCLRHPNCESAHKNKEGVFDRMKVALDKVIEIVTD---------------CKPNGETDISSIS 291

  Fly   263 IYTTIKRIVNLIKRYKYQMSYYEGSGEGNNNSDAYFSFLDDDLWKSEKNLPSAAGGGRMVNNTNF 327
            |:|.||         :::|           |.:|                              .
Human   292 IFTGIK---------EFKM-----------NIEA------------------------------L 306

  Fly   328 RKHLSSESLDLREELSLAFEKLFEKAHDFTDSPYISHNHRKNILSYCDNCKLEFDLYLNTIMKDQ 392
            |::|..:|   :|.||:..|.:.|:..|||||.|.||.||:.||......::|....::..::.|
Human   307 RENLYFQS---KENLSVTLEVILERMEDFTDSAYTSHEHRERILELSTQARMELQQLISVWIQAQ 368

  Fly   393 HEGGGGAGGVGGVGGGQVKGRS---DPELGMLS---SLEELCKQLVVSVSSQIEDFNESLKICSK 451
            .:                |.:|   :.||.:|.   ||.||.|:|..:.:....|.   ||..:.
Human   369 SK----------------KTKSIAEELELSILKISHSLNELKKELHSTATQLAADL---LKYHAD 414

  Fly   452 --LVKSFHVLATNYDIDNLNQRSSKFHDCCDHIFDICKLLQHIAPTERLQVQAKCLAINLRIYGP 514
              ::|:..:.....:::.|.:.:.|..:..:.:.:.|:||:||:.||.|::.........::.|.
Human   415 HVVLKALKLTGVEGNLEALAEYACKLSEQKEQLVETCRLLRHISGTEPLEITCIHAEETFQVTGQ 479

  Fly   515 QVFIAAKILWKYSNSSAANENFESFSDMWKWLTNEISMIAKKILVSINTTKGDR----DADAEKC 575
            |:..||:.|..:.:|..|.||.:.|.:.|:...:::|.:.::|.......:|::    .......
Human   480 QIISAAETLTLHPSSKIAKENLDVFCEAWESQISDMSTLLREINDVFEGRRGEKYGYLSLPKPMK 544

  Fly   576 ESSSDKLTKSGVPATEDGEMVEYSGLE-GKNNGDLNTYQSKWSEDLSDDNDILKRAKNMSAMAFL 639
            .:::.|..|...|.:|:...:...||: |....|.:....||.:   .:|:|::..:|||:||:.
Human   545 NNANLKSLKPDKPDSEEQAKIAKLGLKLGLLTSDADCEIEKWED---QENEIVQYGRNMSSMAYS 606

  Fly   640 MYQFTKGNGSLRTTQDLFTQAEYFAEEANRLYKVLRHFSYQVPASDNKKDLLNILDRVPTFVQAL 704
            :|.||:|.|.|:|:|||..|.|.||.|..:|...::.||.|:...|....||.|...:|...| |
Human   607 LYLFTRGEGPLKTSQDLIHQLEVFAAEGLKLTSSVQAFSKQLKDDDKLMLLLEINKLIPLCHQ-L 670

  Fly   705 QFTVKDHTVGKAATFVKVDHVIRETKNLMNVINKVVSKCFECATKYKLNLTGITGGLTSERSNEN 769
            |...|.....|  .|:|||..|.:|:::|.::.:::|.|::...|.::.    ..|..|..:.:.
Human   671 QTVTKTSLQNK--VFLKVDKCITKTRSMMALLVQLLSLCYKLLKKLQME----NNGWVSVTNKDT 729

  Fly   770 MAGGMCDSK 778
            |     |||
Human   730 M-----DSK 733

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 205/720 (28%)
CTNNAL1NP_003789.1 Vinculin 92..675 CDD:279395 193/674 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80382879
eggNOG 1 0.900 E1_KOG3681
Hieranoid 1 1.000
Homologene 1 1.000 H2815
Inparanoid 1 1.050 289 1.000 Inparanoid score I2775
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D127258at33208
OrthoFinder 1 1.000 FOG0006446
OrthoInspector 1 1.000 T1072149
orthoMCL 1 0.900 OOG5_133957
Panther 1 1.100 LDO PTHR46342
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5795
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.