DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and VCL

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_054706.1 Gene:VCL HGNCID:12665 Length:1134 Species:Homo sapiens

Alignment Length:1140 Identity:172/1141 (15%)
Similarity:323/1141 (28%) Gaps:485/1141 (43%)


  Fly    38 AVERFITIGEIIAEENID--IKGDMYEAAKEARDAGKSIERLCDISPLSGMELRHHIEPLKDYGA 100
            ||...:.:|:...:...|  :|.||..|..:..:|...:.:...:     ::...:..|.:||  
Human    50 AVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQM-----LQSDPYSVPARDY-- 107

  Fly   101 IILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASESLEKLESVMNFTEFVRAFSVFGTEMIELA 165
            :|..:|.:||..:.:||..|...|:|::...|...|.|...|.|....:.|......|..|.::|
Human   108 LIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMA 172

  Fly   166 YLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTSSKNSLIHSDCVIVKENRDTVFCQIRRAMD 230
            .:....:.....:..|..:.::...:::.:.:|:::.|                           
Human   173 KMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMK--------------------------- 210

  Fly   231 LIHFVVKDSIFDTAKHMPFEKQASNPNYENESIYTTIKRIVNLIKRYKYQMSYYEGSGEGNNNSD 295
             |....|:|     |:...|:...|.|:..|.:...|..|:.::     |::.::.....:.:::
Human   211 -IFVTTKNS-----KNQGIEEALKNRNFTVEKMSAEINEIIRVL-----QLTSWDEDAWASKDTE 264

  Fly   296 AY---FSFLDDDL-----WKSEKNLPSAAGG-----------------GRMVNNTNFRK------ 329
            |.   .:.:|..|     |..:   |||:.|                 |.:......|:      
Human   265 AMKRALASIDSKLNQAKGWLRD---PSASPGDAGEQAIRQILDEAGKVGELCAGKERREILGTCK 326

  Fly   330 ---HLSSESLDLR---------------------EELSLAFEKLFEKAHDFTDSPY-------IS 363
               .::.:..|||                     :.|:...|....|....|:|..       .:
Human   327 MLGQMTDQVADLRARGQGSSPVAMQKAQQVSQGLDVLTAKVENAARKLEAMTNSKQSIAKKIDAA 391

  Fly   364 HN--------------------HRKNILSYCDNCKLEFDLY--------LNTIMKDQHEGGGG-- 398
            .|                    ..:.|...||:.|...|:.        |.:.:.|....|.|  
Human   392 QNWLADPNGGPEGEEQIRGALAEARKIAELCDDPKERDDILRSLGEISALTSKLADLRRQGKGDS 456

  Fly   399 -------------------------------------AGGV--------------GGVGGGQVKG 412
                                                 .|.:              .|||...::|
Human   457 PEARALAKQVATALQNLQTKTNRAVANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRG 521

  Fly   413 ----------------RSDPELGMLSSLEELCKQL-------------VVSVSSQIEDFNESLKI 448
                            |.| .|.....:::|..||             ..:::||::|..:.||.
Human   522 LVAEGHRLANVMMGPYRQD-LLAKCDRVDQLTAQLADLAARGEGESPQARALASQLQDSLKDLKA 585

  Fly   449 ----------------CSKLVKSFHVLAT-NYDIDN----LNQRSSKFHDCCDHIFDICKLLQHI 492
                            .:..:|...|.|| ..|..|    .::|::.|.   :|...:....:..
Human   586 RMQEAMTQEVSDVFSDTTTPIKLLAVAATAPPDAPNREEVFDERAANFE---NHSGKLGATAEKA 647

  Fly   493 A--------PTERLQVQAKCLAINLRIYGPQVFIAAKILWKYSNSSAANENFESFSDMW------ 543
            |        ..|.:|...|    ..|...|||..||:||.:...:.||.|:||:..:.|      
Human   648 AAVGTANKSTVEGIQASVK----TARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEK 708

  Fly   544 --------------------------------------KWLTNEISMIAKK----ILVSINTTKG 566
                                                  :.|....:.||::    :||:....:.
Human   709 MTGLVDEAIDTKSLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKREVEN 773

  Fly   567 DRDAD-AEKCESSSDKLTKS--------------------------------------------- 585
            ..|.. .|..:::||:|:|:                                             
Human   774 SEDPKFREAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQ 838

  Fly   586 ----------------------------------------------------------------- 585
                                                                             
Human   839 EPDFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMMAAR 903

  Fly   586 -------------GVPATEDG---------------------------EMVEYSGLEGKNNGDLN 610
                         |:||.|.|                           |::.....:..|...|.
Human   904 QLHDEARKWSSKPGIPAAEVGIGVVAEADAADAAGFPVPPDMEDDYEPELLLMPSNQPVNQPILA 968

  Fly   611 TYQS------KWSEDLSDDNDILKRAKNMSAMAFLMYQFTKGNGSLRTTQDLFTQAEYFAEEANR 669
            ..||      |||   |..|||:..||.|:.:...|.:..:|...  |.:.|...|:..|:.::.
Human   969 AAQSLHREATKWS---SKGNDIIAAAKRMALLMAEMSRLVRGGSG--TKRALIQCAKDIAKASDE 1028

  Fly   670 LYKVLRHFSYQVPASDNKKDLLNILDRVPTFVQALQF--TVKDHTVGKA---------ATFVKVD 723
            :.::.:..:.|......:.:||.:.:|:||....|:.  |||...:|:.         ||    :
Human  1029 VTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQAT----E 1089

  Fly   724 HVIRETKNLMNVINKVVSKCFECATKYKLNLTGIT 758
            .::...:|||..:.:.|.:....:.|.:.: .|.|
Human  1090 MLVHNAQNLMQSVKETVREAEAASIKIRTD-AGFT 1123

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 167/1122 (15%)
VCLNP_054706.1 N-terminal globular head. {ECO:0000269|PubMed:20484056} 1..835 126/841 (15%)
Vinculin 66..1134 CDD:279395 169/1125 (15%)
Talin-interaction. {ECO:0000250|UniProtKB:P12003} 168..208 4/40 (10%)
3 X 112 AA tandem repeats. {ECO:0000255} 259..589 44/334 (13%)
Interaction with ACTN4. {ECO:0000244|PDB:1YDI, ECO:0000269|PubMed:15988023} 741..764 3/23 (13%)
Linker (Pro-rich). {ECO:0000269|PubMed:20484056} 836..878 0/42 (0%)
C-terminal tail. {ECO:0000269|PubMed:20484056} 879..1134 46/256 (18%)
Facilitates phospholipid membrane insertion. {ECO:0000250|UniProtKB:Q64727} 1003..1046 6/45 (13%)
Facilitates phospholipid membrane insertion. {ECO:0000250|UniProtKB:Q64727} 1120..1134 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.