| Sequence 1: | NP_726389.4 | Gene: | alpha-Catr / 49713 | FlyBaseID: | FBgn0029105 | Length: | 810 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001357870.1 | Gene: | Vinac1 / 668894 | MGIID: | 3649276 | Length: | 1413 | Species: | Mus musculus |
| Alignment Length: | 218 | Identity: | 44/218 - (20%) |
|---|---|---|---|
| Similarity: | 93/218 - (42%) | Gaps: | 21/218 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 17 RDMDNEQIMSTFGNIGHLLNIAVERFITIGEIIAEENID--IKGDMYEAAKEARDAGKSIERLCD 79
Fly 80 ISPLSGMELRHHIEP--LKDYGAIILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASESLEKLE 142
Fly 143 SVMNFTEFVRAFSVFGTEMIELAYLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTSSKNSLI 207
Fly 208 HSDCVIVKENRDTVFCQIRRAMD 230 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| alpha-Catr | NP_726389.4 | Vinculin | 52..755 | CDD:279395 | 37/183 (20%) |
| Vinac1 | NP_001357870.1 | Vinculin | 15..>610 | CDD:366435 | 44/218 (20%) |
| Vinculin | <1224..1375 | CDD:366435 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3681 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||