DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and ctnna2

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:XP_005160129.1 Gene:ctnna2 ZFINID:ZDB-GENE-060815-3 Length:905 Species:Danio rerio

Alignment Length:863 Identity:186/864 (22%)
Similarity:337/864 (39%) Gaps:221/864 (26%)


  Fly    33 HLLNIAVER----FITIGEIIAEENIDIKGDMYEAAKEARDAGKSI----ERLCDISPLSGMELR 89
            |:|.::||:    |:..||.||:::.|:|.::..|.::.|..|.::    ....| .|.|.::  
Zfish    58 HVLAVSVEQATQNFLEKGEQIAKDSQDLKEELIAAVEDVRKQGDTMRVASSEFAD-DPCSSVK-- 119

  Fly    90 HHIEPLKDYGAIILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASESLEKLESVMNFTEFVRAF 154
                    .|.::.|||:|||:|||:|:|.|:..|.:||...|...|:||.:::..|..:....|
Zfish   120 --------RGTMVRAARALLSAVTRLLILADMADVMRLLAHLKIVEEALEAVKNATNEQDLANRF 176

  Fly   155 SVFGTEMIELAYLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTSSKNSLIHSDCVIVKENRD 219
            ..||.||::|.|:....:...|:.:.|.:|.:||..|:|:..:|.|:|:..|.|.|....:.|||
Zfish   177 KEFGKEMVKLNYVAARRQQELKDPQCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANRD 241

  Fly   220 TVFCQIRRAMDLIHFVVKDSIFDTAKHMPFEKQASNPNYENESIYTTIKRIVNLIKRYKYQMSYY 284
            .||.|::.|:        ..|..:|       ||::|..|...                     :
Zfish   242 YVFKQVQEAI--------GGISSSA-------QATSPTDEKHG---------------------H 270

  Fly   285 EGSGE---GNNNSDAYFSFLDDDLWKS--------EKNLPSAAGGGRMVNNTNF-----RKHLSS 333
            .|.||   ..|..|.  ..:.|.|..|        |:.|.|...|..::.:::.     |:.:.:
Zfish   271 AGIGELAAALNEFDN--KIILDPLTFSEARFRPSLEERLESIISGAALMADSSCTRDDRRERIVA 333

  Fly   334 ESLDLR--------------------EELSLAFEKLFEKAHDFTDSPYISHNHRKNILSYCDNCK 378
            |...:|                    :.|:.|.:|:.:|..|      :....||.::.:..:..
Zfish   334 ECNAVRQALQDLLSEYMNNTGRKEKGDPLNSAIDKMTKKTRD------LRRQLRKAVMDHISDSF 392

  Fly   379 LEFDLYLNTIMKDQHEGGGGAGGVGGVGGGQVK---------------------GRSDPELGM-- 420
            ||.::.|..:::....|          ...:||                     ..|:.|.|:  
Zfish   393 LETNVPLLVLIEAAKSG----------NEKEVKEYAQVFREHANKLVEVANLACSISNNEEGVKL 447

  Fly   421 ----LSSLEELCKQLV------------------------------------VSVSSQIEDF--- 442
                .:.::.||.|::                                    |...:.::||   
Zfish   448 VRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRILTEAVDDITSVDDFLSV 512

  Fly   443 --NESLKICSKLVKSFHVLATNYDIDNLNQRSSKFHDCCDHIFDICKL-LQHIAP---TERLQVQ 501
              |..|:..:|.|    :.....|:|.|::.:.........:..|... :::..|   |||:...
Zfish   513 SENHILEDVNKCV----IALQEGDVDTLDRTAGAIRGRAARVVHIINAEMENYEPGVYTERVLES 573

  Fly   502 AKCLAIN-LRIYGPQVFIAAKILWKYSNSSAANENFE--SFSDMWKWLTNEISMIAKKILVSINT 563
            .|.|:.. :..:..||.:|.:.|     |::..:.||  .|.|..:.:.:.:..|.|.:|:....
Zfish   574 IKLLSETVMPRFAEQVEVAIEAL-----STSPPQPFEENEFIDASRLVYDGVRDIRKAVLMIRTP 633

  Fly   564 TKGDRDADAEK----------CESSSDKL--------TKSGVPATEDGEMVEYSGLEGKNNGDLN 610
            .:.:.|:|.|:          .::..|:|        ..:.:|..|..::.|......:....|:
Zfish   634 EELEDDSDFEQEDYDARSRTSIQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVESFRQEKSKLD 698

  Fly   611 TYQSKWSEDLSDDNDILKRAKNMSAMAFLMYQFTKGNGSLRTTQDLFTQAEYFAEEANRLYKVLR 675
            ...:||.:   :.|||:..||.|..:...|..||:|.|.|:.:.|:...|:..||..:|:.|:.|
Zfish   699 AEVAKWDD---NGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNSSDVINAAKKIAEAGSRMDKLAR 760

  Fly   676 HFSYQVPASDNKKDLLNILDRVPTFVQALQF--TVKDHTVGKAATFV-----KVDHVIRETKNLM 733
            ..:.|.|.|..|:|||..|.|:..:...|..  .||..........:     ....:|:..||||
Zfish   761 AVADQCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLM 825

  Fly   734 NVINKVVSKCFECATKYK 751
            |.:...|...:..:|||:
Zfish   826 NAVVLTVKASYVASTKYQ 843

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 177/841 (21%)
ctnna2XP_005160129.1 Vinculin 82..866 CDD:279395 177/840 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.