DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and Ctnnal1

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_061231.3 Gene:Ctnnal1 MGIID:1859649 Length:731 Species:Mus musculus

Alignment Length:783 Identity:218/784 (28%)
Similarity:379/784 (48%) Gaps:118/784 (15%)


  Fly     7 STVNNQRFRVRDMDNEQIMSTFGNIGHLLNIAVERFITIGEIIAEENIDIKGDMYEAAKEARDAG 71
            :|:.|.:...:..|  :.:.....:|..:|:||.||:.:||.||.||.|:|.::..|..||:.||
Mouse    48 TTLINHKDNTKKSD--KTLQAIQRVGQAVNLAVGRFVKVGEAIANENWDLKEEINIACIEAKQAG 110

  Fly    72 KSIERLCDISPLSGMELRHHIEPLKDYGAIILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASE 136
            ::|..|.|::..|.:|....:..|.|...::.|||.||||||::|||.|.:|:|:::|::.:...
Mouse   111 ETIASLTDVTKRSHLESDGQVTILTDKTGVVQAARLLLSSVTKVLLLADRVVIKQIVTSRNKILA 175

  Fly   137 SLEKLESVMNFTEFVRAFSVFGTEMIELAYLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTS 201
            ::|:||.|.:|.|||:.||.||.||:|.|:|||..:|..|:|:::|:|..||.:|||...:|||:
Mouse   176 TMERLEKVNSFQEFVQIFSQFGNEMVEFAHLTGDRQNDLKDEKKKARMAVARAVLEKGTMMLLTA 240

  Fly   202 SKNSLIHSDCVIVKENRDTVFCQIRRAMDLIHFVVKDSIFDTAKHMPFEKQASNPNYENESIYTT 266
            ||..|.|..|.....|::.||.::|.|::.:..:|.|.           :.:...:..:.||:|.
Mouse   241 SKTCLRHPSCESAHTNKEGVFDRMRVALEKVTEIVTDC-----------RLSGETDSSSVSIFTG 294

  Fly   267 IKRIVNLIKRYKYQMSYYEGSGEGNNNSDAYFSFLDDDLWKSEKNLPSAAGGGRMVNNTNFRKHL 331
            ||.:                                                  .||....|:::
Mouse   295 IKEL--------------------------------------------------KVNIEALRENV 309

  Fly   332 SSESLDLREELSLAFEKLFEKAHDFTDSPYISHNHRKNILSYCDNCKLEFDLYLNTIMKDQHEGG 396
            ..||   :|.||.|.|.:.|...|||||.|.||.||:.||......:.|....|:..|:.|....
Mouse   310 CFES---KENLSAALEAVLEHVEDFTDSAYTSHEHRERILELSSQARTELQQLLSVWMQTQSRKT 371

  Fly   397 GGAGGVGGVGGGQVKGRSDPELGMLS---SLEELCKQL---VVSVSSQIEDFNESLKICSKLVKS 455
            ..|.             .:.||.:|.   ||:||.::|   .:.:::.:..|:..    ..::|:
Mouse   372 KSAA-------------EELELTVLKISHSLDELRRELHCTAMQLAADLLKFHAD----HVVLKA 419

  Fly   456 FHVLATNYDIDNLNQRSSKFHDCCDHIFDICKLLQHIAPTERLQVQAKCLAINLRIYGPQVFIAA 520
            ..|.....:::.|.:.:.|..:..:.:.:.|:||:||:.||.|::.........::.|.|:..||
Mouse   420 LKVTGVEGNLEALAEYACKLSEQKEQLVETCRLLRHISGTEPLEITCIHAEETFQVTGQQIISAA 484

  Fly   521 KILWKYSNSSAANENFESFSDMWKWLTNEISMIAKKILVSINTTKGDRDADAEKCE--------- 576
            :.|..:.:|..|.||.:.|.:.|:...::::.:.::|.......:|      |:|:         
Mouse   485 ETLTLHPSSKIAKENLDVFCEAWESQMSDMATLLREISDVFEGRRG------ERCDHLSLPKPTK 543

  Fly   577 -SSSDKLTKSGVPATEDGEMVEYSGLE-GKNNGDLNTYQSKWSEDLSDDNDILKRAKNMSAMAFL 639
             |::.|..|...|.:|:...:...||: |..:.|.:....||.:   ::|:|::..:|||.||:.
Mouse   544 NSANLKSLKPDKPDSEEQAKIAKLGLKLGLLSSDADCEIEKWED---EENEIVRHGRNMSRMAYS 605

  Fly   640 MYQFTKGNGSLRTTQDLFTQAEYFAEEANRLYKVLRHFSYQVPASDNKKDLLNILDRVPTFVQAL 704
            :|.||:|.|.|:|:|||....|.||.|..:|...::.||.|:...|....||.|...:|...| |
Mouse   606 LYLFTRGEGPLKTSQDLIHFLEVFAAEGLKLTSSVQSFSKQLKDDDKLMLLLEINKLIPLCHQ-L 669

  Fly   705 QFTVKDHTVGKAATFVKVDHVIRETKNLMNVINKVVSKCFECATKYKLNLTGITGGLTSERSNEN 769
            |...|  |..::..|:|||..|.:.:::|.::.:::|.|::...|.:.|..|      |..:.:.
Mouse   670 QTITK--TSLQSKVFLKVDKCITKIRSMMTLVVQLLSLCYKLLKKMENNRWG------SATNKDT 726

  Fly   770 MAG 772
            |.|
Mouse   727 MDG 729

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 201/720 (28%)
Ctnnal1NP_061231.3 Vinculin 91..674 CDD:279395 189/674 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80384785
eggNOG 1 0.900 E1_KOG3681
Hieranoid 1 1.000
Homologene 1 1.000 H2815
Inparanoid 1 1.050 293 1.000 Inparanoid score I2738
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006446
OrthoInspector 1 1.000 T1082205
orthoMCL 1 0.900 OOG5_133957
Panther 1 1.100 LDO PTHR46342
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5795
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.