DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and alpha-Cat

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_524219.1 Gene:alpha-Cat FlyBaseID:FBgn0010215 Length:917 Species:Drosophila melanogaster

Alignment Length:893 Identity:184/894 (21%)
Similarity:305/894 (34%) Gaps:289/894 (32%)


  Fly    38 AVERFITIGEIIAEENIDIKGDMYEAAKEARDAGKSIE---RLCDISPLSGMELRHHIEPLKDYG 99
            |.|.||..||.||.||.||..:|..|..|.:..|.::.   |.....|.|.::          .|
  Fly    73 ATENFIQKGEQIAYENPDITQEMLTAVDEVKKTGDAMSIAAREFSEDPCSSLK----------RG 127

  Fly   100 AIILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASESLEKLESVMNFTEFVRAFSVFGTEMIEL 164
            .::.|||:|||:|||:|:|.|::.|..||.:.....:.|.||::..:..|.:.....||....||
  Fly   128 NMVRAARNLLSAVTRLLILADMVDVHLLLKSLHIVEDDLNKLKNASSQDELMDNMRQFGRNAGEL 192

  Fly   165 AYLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTSSKNSLIHSDCVIVKENRDTVFCQIRRAM 229
            .......:...|:.:.|..:.:||.:|:|...:|||:||..:.|.:..:.|.|||.:..|:..|:
  Fly   193 IKQAAKRQQELKDPQLRDDLAAARAMLKKHSTMLLTASKVYVRHPELDLAKVNRDFILKQVCDAV 257

  Fly   230 DLIHFVVKDSIFDTAKHMPFEKQASNPNYENESIYTTIKRIVNLIKRYKYQMSYYEGSGEGNNNS 294
                    ::|.|.|     :.::|.|.                        ..|.|:||     
  Fly   258 --------NTISDVA-----QGKSSQPT------------------------DIYSGAGE----- 280

  Fly   295 DAYFSFLDDDLWKSEKNLPSAAGGGRMVNNTNFRKHLSSESLDLREELSLAFEKLFEKAHDFTDS 359
              ..:.|||            ...|.:::...:.:..|.:.|:.|      .|.:...|....|:
  Fly   281 --LAAALDD------------FDEGIVMDPMTYSEKRSRQLLEER------LESIISAAALMADA 325

  Fly   360 PYISHNHRKNILSYCDNCKLEFDLYLNTIMKDQHEGGGGAGGVGGVGGGQVKGRSDPELGMLSSL 424
            .......|:.|::.|:..:......|:..|.:.                   .:.|...|:..::
  Fly   326 DCTRDERRERIVAECNAVRQALQDLLSEYMSNM-------------------SQKDNSPGLSRAI 371

  Fly   425 EELC-------KQLVVSVSSQIED-FNESLKICSKLVKSFHVLATNYDIDNLNQRSSKFHDCCDH 481
            :::|       :||..:|...:.| |.|:......|:::    |.:.:...:.::|..|....:.
  Fly   372 DQMCRKTRDLRRQLRKAVVDHVSDSFLETTTPLLDLIEA----AKSGNEKKVREKSEIFTKHAEK 432

  Fly   482 IFDICKLLQHIAPTERLQVQAKCLAINLRIYGPQVFIAAKILWKYSNSSAANENFESFSDMW--- 543
            :.::..|:..::..|......:..|..:....|||..||.||....||..|.||..::...|   
  Fly   433 LVEVANLVCSMSNNEDGVKMVRYAAAQIESLCPQVINAASILTVRPNSKVAQENMTTYRQAWEVQ 497

  Fly   544 -KWLT---NEISMIAKKILVSINTTKGDRDADAEKC----------------------------- 575
             :.||   ::|:.|...:.||.|...    .|..||                             
  Fly   498 VRILTEAVDDITTIDDFLAVSENHIL----EDVNKCVMALQVGDARDLRATAGAIQGRSSRVCNV 558

  Fly   576 -ESSSD--------KLTKSGVPATEDGEMVEY--------SGLEGKNNGDLN------------- 610
             |:..|        |.....|....|..|:::        ..|...:|.|::             
  Fly   559 VEAEMDNYEPCIYTKRVLEAVKVLRDQVMMKFDQRVGAAVGALSNNSNKDVDENDFIDASRLVYD 623

  Fly   611 --------TYQSKWSEDLSDD-------------------------------------------- 623
                    ...::.||||..|                                            
  Fly   624 GVREIRRAVLMNRSSEDLDTDTEFEPVEDLTLETRSRSSAHTGDQTVDEYPDISGICTAREAMRK 688

  Fly   624 ----------------------------------NDILKRAKNMSAMAFLMYQFTKGNGSLRTTQ 654
                                              |||:..||:|..:...|..||:|.|.|:||.
  Fly   689 MTEEDKQKIAQQVELFRREKLTFDSEVAKWDDTGNDIIFLAKHMCMIMMEMTDFTRGRGPLKTTM 753

  Fly   655 DLFTQAEYFAEEANRLYKVLRHFSYQVPASDNKKDLLNILDRVPTFVQALQFTVKDHTVGKAATF 719
            |:...|:..:|...:|.|:.|..:.|.|.|..|||||..|.|:..:...:|.|.|          
  Fly   754 DVINAAKKISEAGTKLDKLTREIAEQCPESSTKKDLLAYLQRIALYCHQIQITSK---------- 808

  Fly   720 VKVD-----------------HVIRETKNLMNVINKVVSKCFECATKY 750
            ||.|                 .:|:..|||||.:...|...:..:|||
  Fly   809 VKADVQNISGELIVSGLDSATSLIQAAKNLMNAVVLTVKYSYVASTKY 856

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 176/880 (20%)
alpha-CatNP_524219.1 Vinculin 87..877 CDD:279395 176/880 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80427771
eggNOG 1 0.900 E1_KOG3681
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.