DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and Ctnna3

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:XP_008771167.2 Gene:Ctnna3 RGDID:1562230 Length:895 Species:Rattus norvegicus

Alignment Length:853 Identity:174/854 (20%)
Similarity:294/854 (34%) Gaps:243/854 (28%)


  Fly    46 GEIIAEENIDIKGDMYEAAKEARDAGKSIERLCDISPLSGMELRHHIEP--LKDYGAIILAARSL 108
            ||:||:|...:|.|:..|.:|.|...|:         |.|...|...:|  |....|::.|||:|
  Rat    73 GEMIAKEATVLKEDLEAALQEVRKESKA---------LKGSAERFTDDPCYLPKREAVVQAARAL 128

  Fly   109 LSSVTRILLLVDIIVVKKLLTAKKRASESLEKLESVMNFTEFVRAFSVFGTEMIELAYLTGHHRN 173
            |::|||:|:|.|:..|..||........:.:.|::|.|.::..:.:...|.|:..|.......:.
  Rat   129 LAAVTRLLILADMTDVMCLLQHVSSFQRTFKSLKNVSNKSDLQKTYQKLGKELERLDRFAFKRQQ 193

  Fly   174 SFKEERRRAQMFSARQILEKSIAILLTSSKNSLIHSDCVIVKENRDTVFCQIRRAMDLIHFVVKD 238
            ..|...:|.::..||..|:::..:|.:.....|.|||...:|.::|||..:|:.|:|:|      
  Rat   194 DLKSPSQRDEIAGARATLKENSPLLHSICSACLEHSDVASLKASKDTVCEEIQNALDVI------ 252

  Fly   239 SIFDTAKHMPFEKQASNPNYENESIYTTIKRIVNLIKRYKYQMSYYEGSGEGNNNSDAYFSFLDD 303
                           ||                               :.:|..|..|...    
  Rat   253 ---------------SN-------------------------------ASQGIQNVPASLE---- 267

  Fly   304 DLWKSEKNLPSAAGGGRMVN---NTNFRKHLSSESLDLREELSLAFEKLFEKAHDFTDSPYISHN 365
                     |.||..|..::   |......|:....|||..|....|.:...|....||......
  Rat   268 ---------PQAATLGSALDELENLIVLNPLTVTEEDLRPPLEKRLEAIISGAALLADSSCTRDL 323

  Fly   366 HRKNILSYCDNCKLEF-DL---YLNTIMKDQHEGGGGAGGVGGVGGGQVKGRSDPELGMLSSLEE 426
            ||:.|::.|:..:... ||   |::.|.|.:.........|                .|.....:
  Rat   324 HRERIIAECNAIRQALQDLLSEYMSNIGKTERSNTLNTAIV----------------NMSKKTRD 372

  Fly   427 LCKQLVVSVSSQIED-FNESLKICSKLVKSFHVLATNYDIDNLNQRSSKFHDCCDHIFDICKLLQ 490
            |.:||..::...|.| |.::......|:::    |.|..:..:...:|.||:....:.::..|..
  Rat   373 LRRQLRKAIIDHISDSFLDTTVPLLVLIEA----AKNGQVKEIKDYASIFHEHTGRLMEVANLAC 433

  Fly   491 HIAPTERLQVQAKCLAINLRIYGPQVFIAAKILWKYSNSSAANENFESFSDMWKW----LT---N 548
            .::..|......:..|.:|....||:..||..|.....|.......|.:...|:.    ||   :
  Rat   434 SMSTNEDGIKIVRIAANHLETLCPQIINAALALASRPKSQVVKNTMEMYKRTWEHYIHVLTEAVD 498

  Fly   549 EISMIAKKILVSINTTKGD--------RDADAEKCESSS-------------------------- 579
            :|:.|...:.||.:....|        ||.||:..:.::                          
  Rat   499 DITSIDDFLAVSESHILEDVNRCIIALRDQDADNLDRAAGAIRGRAARVAHIVAGEMDSYEPGAY 563

  Fly   580 ---------------------------DKLTKSGVPATEDGEMVEYS------------------ 599
                                       |.|:|:.:.|.:|.:.|:.|                  
  Rat   564 TEGVMRNVNLLTSIVIPEFVTQVNVALDALSKNALTALDDNQFVDISKKIYDTIHDIRCSVMIIR 628

  Fly   600 -----------------------GLEGKNN-------------------GDLNTYQSKWSEDLS- 621
                                   ..|||.:                   .|....:||...::. 
  Rat   629 TPEELEDVSDLEDDHEVRSHTSTQTEGKTDRAKMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEI 693

  Fly   622 -DD--NDILKRAKNMSAMAFLMYQFTKGNGSLRTTQDLFTQAEYFAEEANRLYKVLRHFSYQVPA 683
             ||  |||:..||.|..:...|..||:|.|.|:.|.|:...|:..:|..:|:..:.|..:.|.|.
  Rat   694 WDDTSNDIIVLAKKMCMIMMEMTDFTRGKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPD 758

  Fly   684 SDNKKDLLNILDRVPTFVQAL----QFTVKDHTVGKAATFVKVDHV---IRETKNLMNVINKVVS 741
            ...|:|||..|:::..:...|    |...:...:|.......:|.|   |:..|||||.:.:.|.
  Rat   759 PPCKQDLLAYLEQIKFYSHQLKICSQVKAEIQNLGGELIVSALDSVTSLIQAAKNLMNAVVQTVK 823

  Fly   742 KCFECATK 749
            ..:..:||
  Rat   824 MSYIASTK 831

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 170/848 (20%)
Ctnna3XP_008771167.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.