DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and Vinc

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_001284813.1 Gene:Vinc FlyBaseID:FBgn0004397 Length:961 Species:Drosophila melanogaster

Alignment Length:1028 Identity:159/1029 (15%)
Similarity:312/1029 (30%) Gaps:432/1029 (42%)


  Fly    34 LLNIAVERFITIGE--IIAEENIDIKGDMYEAAKEARDAGKSIERLCDI---SPLSGMELRHHIE 93
            :::.||...:.:|.  |.:.::..::.||..|......|.:.:|...|:   .|.||...:..||
  Fly    45 VVSAAVANLVKVGRDTINSSDDKILRQDMPSALHRVEGASQLLEEASDMLRSDPYSGPARKKLIE 109

  Fly    94 PLKDYGAIILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASESL---EKLESVMNFTEFVRAFS 155
                      .:|.:|...:.:||..|...|:|::...||..:.|   |.:.::....:|::..|
  Fly   110 ----------GSRGILQGTSSLLLCFDESEVRKIIQECKRVLDYLAVAEVINTMEQLVQFLKDLS 164

  Fly   156 VFGTEMIELAYLTGHHRNSFKEERRRAQMFSARQILE-----KSIAILLTSSKNSLIHSDCVIVK 215
                     ..|:..||.....|:.......:..::.     |::|.:|..|....||   ::.:
  Fly   165 ---------PCLSKVHREVGAREKELTHQVHSEILVRCLEQVKTLAPILICSMKVYIH---IVEQ 217

  Fly   216 ENRDTVFCQIRRAMDLIHFVVKDSIFDTAKHMPFEKQASNPNYENESIYTTIKRIVNLIKRYKYQ 280
            :.|..                             |:.|.|.||....:...::.|:.::     |
  Fly   218 QGRGA-----------------------------EEAAENRNYLAARMSDELQEIIRVL-----Q 248

  Fly   281 MSYYEGSGEGNNNSDAYFSFLDDDLWKSEKNLPSAAGGGRMVNNTNFRKHLSSESLDLREELSLA 345
            ::.|                 |:|  .||                       .::|.:.::||.|
  Fly   249 LTTY-----------------DED--TSE-----------------------LDNLTVLKKLSNA 271

  Fly   346 FEKLFEKAHDFTDSPYISHN--HRKNILSYCDNC----------------KL--EFDLYLNTIMK 390
            .....|:|:::..:||....  ..|.:....||.                ||  |.....||:.:
  Fly   272 ISNKMEQANEWLSNPYALRGGVGEKALRQVIDNATEISERCLPQDSYPIRKLADEVTAMANTLCE 336

  Fly   391 DQHEGGGGAG-------------------------GVGGVGGGQ----VKGRSD--------PEL 418
            .:.||.|.:.                         ||...|..|    ::||.:        ||:
  Fly   337 LRQEGKGQSPQAESLVRGIRDRMGELKSLVHQAVLGVDKAGVQQTAHTIQGRLEQAVKWLQHPEI 401

  Fly   419 G--------------------------MLSSLEELC-----------------KQLVVSVSSQIE 440
            .                          ..:.:::||                 ||....::.::.
  Fly   402 NDGGLGERAINLIVEEGRKVAEGCPGHQKAEIQQLCDEVERLKRQAAGSGPAAKQAAKQLTQKLY 466

  Fly   441 DFNESLK--ICSKLVKSFHVLATNYD---------------IDNLNQRSSK---FHD-------- 477
            :...:::  :.:::|:.|..::|...               ..|.||:|:.   |.|        
  Fly   467 ELKAAIQNALVNRIVQDFMDVSTPLKQFTEAVLQPEGTPGREQNFNQKSNNLQAFSDRASKTSRM 531

  Fly   478 -----CCDHIFDICKLLQHIAPTERLQVQAKCLAINLRIYGPQVFIAAKILWKYSNSSAANENFE 537
                 .|.:     |.:..|..:...||.:         ..||:..|.:|...|..|.||:|:.:
  Fly   532 VAAGGACGN-----KKIAEILLSSAAQVDS---------LTPQLISAGRIRMNYPGSKAADEHLQ 582

  Fly   538 SFSDMW---------------------------------------------KWL--TNEISMIAK 555
            :....:                                             |.:  |:.|:.:..
  Fly   583 NLKQQYADTVLRMRTLCDQATDPADFIKTSEEHMQVYAKLCEDAIHARQPQKMVDNTSNIARLIN 647

  Fly   556 KILVSINTTKGDRDAD---AEKCESSSDKLTKSGVPATEDGEMV--------------------- 596
            ::|: :...:.|...|   .|:..:::::|.:|......|.::|                     
  Fly   648 RVLL-VAKQEADNSEDPVFTERLNAAANRLERSLPAMVGDAKLVATNIADPAAAAAWKNSFQRLL 711

  Fly   597 ---------------------------EYSGLEGKNNG--------------------------- 607
                                       |.|.|...|..                           
  Fly   712 GDVREVRDAIAPPQPPPLPTSLPPPIPELSALHLSNQNAERAPPRPPLPREGLAPVRPPPPETDD 776

  Fly   608 -DLNTYQS--------------------KWSEDLSDDNDILKRAKNMSAMAFLMYQFTK-----G 646
             |...:::                    :||   |.||:|:..||.   ||.||.:.::     .
  Fly   777 EDEGVFRTMPHANQPILIAARGLHQEVRQWS---SKDNEIIAAAKR---MAILMARLSELVLSDS 835

  Fly   647 NGSLRTTQDLFTQAEYFAEEANRLYKVLRHFSYQVPASDNKKDLLNILDRVPTFVQALQF--TVK 709
            .||.|   :|...|:..||.:..:.::.:..:.|......:.:||.:.:|:||....|:.  |||
  Fly   836 RGSKR---ELIATAKKIAEASEDVTRLAKELARQCTDRRIRTNLLQVCERIPTIGTQLKILSTVK 897

  Fly   710 DHTVG-------KAATFVKVDHVIRETKNLMNVINKVVSKCFECATKYKLNLT 755
            ...:|       :.||    :.::...:|||..:.:.|......:.|.:.:.|
  Fly   898 ATMLGAQGSDEDREAT----EMLVGNAQNLMQSVKETVRAAEGASIKIRSDQT 946

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 154/1007 (15%)
VincNP_001284813.1 Vinculin 63..960 CDD:279395 155/1011 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80427803
eggNOG 1 0.900 E1_KOG3681
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.