DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and Ctnna1

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_001007146.1 Gene:Ctnna1 RGDID:1359485 Length:908 Species:Rattus norvegicus

Alignment Length:946 Identity:197/947 (21%)
Similarity:329/947 (35%) Gaps:293/947 (31%)


  Fly    33 HLLNIAVER----FITIGEIIAEENIDIKGDMYEAAKEARDAG---KSIERLCDISPLSGMELRH 90
            |:|..:||:    |:..|:.||:|:..:|.::..|..:.|..|   ||........|.|.::   
  Rat    59 HVLAASVEQATENFLEKGDKIAKESQFLKEELVAAVDDVRKQGDLMKSAAGEFADDPCSSVK--- 120

  Fly    91 HIEPLKDYGAIILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASESLEKLESVMNFTEFVRAFS 155
                   .|.::.|||:|||:|||:|:|.|:..|.|||...|...:.:.||.:..|..:....:.
  Rat   121 -------RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYR 178

  Fly   156 VFGTEMIELAYLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTSSKNSLIHSDCVIVKENRDT 220
            ....|:.:|..:....:...|:...|.||.:||.||:|::.||.|:|:..|.|.|....|.|||.
  Rat   179 ALKPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRDL 243

  Fly   221 VFCQIRRAMDLIHFVVKDSIFDTAKHMPFEKQASNPNYENESIYTTIKRIVNLIKRYKYQMSYYE 285
            ::.|:::|:..|....:.:..|.|                                     |..:
  Rat   244 IYKQLQQAVTGISNAAQATASDDA-------------------------------------SQQQ 271

  Fly   286 GSGEGNNNSDAYFSFLDDDLWKSEKNLPSAAGGGRMVNN-TNFRKHLSSESLDLREE-----LSL 344
            |.|                           .|||.:... .||.|.:..:.|...||     |..
  Rat   272 GGG---------------------------GGGGELAYALNNFDKQIIVDPLSFSEERFRPSLEE 309

  Fly   345 AFEKLFEKAHDFTDSPYISHNHRKNILSYCDNCKLEFDLYLNTIMKDQHEGGGGAGGVGGVGGGQ 409
            ..|.:...|....||.....:.|:.|::.|:..:......|:..|       |.||.        
  Rat   310 RLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYM-------GNAGR-------- 359

  Fly   410 VKGRSDPELGMLSSLEELCK-------QLVVSVSSQIED-FNESLKICSKLVKSFHVLATNYDID 466
             |.|||   .:.|:::::.|       ||..:|...:.| |.|:......|:::    |.|.:..
  Rat   360 -KERSD---ALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEA----AKNGNEK 416

  Fly   467 NLNQRSSKFHDCCDHIFDICKLLQHIAPTERLQVQAKCLAINLRIYGPQVFIAAKILWKYSNSSA 531
            .:.:.:..|.:..:.:.::..|...|:..|......:..|..|....|||..||..|.....|..
  Rat   417 EVKEYAQVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKL 481

  Fly   532 ANENFESFSDMW----KWLT---NEISMIAKKILVSINTTKGD----------RDAD-------- 571
            |.||.:.|.:.|    :.||   ::|:.|...:.||.|....|          :|.|        
  Rat   482 AQENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRTAGA 546

  Fly   572 -------------------------------------------AEKCESSSDKLTKSGVPATEDG 593
                                                       .|:.|::.:.|:.......::.
  Rat   547 IRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDEN 611

  Fly   594 EMVE-----YSGL-------------EGKNNGDLNT----YQSKWSEDLSDD------------- 623
            |.::     |.|:             |..::.|..|    .:|:.|....||             
  Rat   612 EFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTEDDQLIAGQSARAIMA 676

  Fly   624 -----------------------------------NDILKRAKNMSAMAFLMYQFTKGNGSLRTT 653
                                               |||:..||.|..:...|..||:|.|.|:.|
  Rat   677 QLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNT 741

  Fly   654 QDLFTQAEYFAEEANRLYKVLRHFSYQVPASDNKKDLLNILDRVPTFVQALQFTVK----DHTVG 714
            .|:.:.|:..||..:|:.|:.|..:...|.|..|:|||..|.|:..:...|....|    ...:|
  Rat   742 SDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLG 806

  Fly   715 KAATFVKVD---HVIRETKNLMNVINKVVSKCFECATKYK-------LNLTGITGGLTSERSNEN 769
            .......||   .:|:..|||||.:.:.|...:..:|||:       |||..::..:.:      
  Rat   807 GELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKSQGMASLNLPAVSWKMKA------ 865

  Fly   770 MAGGMCDSKGTTSSSDIPXHYGMARRAKGDARRTRV 805
                             |....:.:|.|.|..:|::
  Rat   866 -----------------PEKKPLVKREKQDETQTKI 884

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 184/872 (21%)
Ctnna1NP_001007146.1 Vinculin 82..869 CDD:279395 185/907 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.