DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and ctnna1

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_571531.1 Gene:ctnna1 ZFINID:ZDB-GENE-991207-24 Length:907 Species:Danio rerio

Alignment Length:888 Identity:190/889 (21%)
Similarity:316/889 (36%) Gaps:264/889 (30%)


  Fly    38 AVERFITIGEIIAEENIDIKGDMYEAAKEARDAGKSIERLCDISPLSGMELRHHIEPLKDYGAII 102
            |.:.|:..||.||:|:..:|.::..|.::.|..|:|::.      .||.........:| .|.::
Zfish    68 ATQNFLEKGEKIAKESQFLKEELTAAVEDVRKQGESMKM------ASGEFAEDPCSSVK-RGNMV 125

  Fly   103 LAARSLLSSVTRILLLVDIIVVKKLLTAKKRASESLEKLESVMNFTEFVRAFSVFGTEMIELAYL 167
            .|||:|||:||.:|:|.|:..|.:||...|...|:|.|:.:.....:....:.....|:.:|..:
Zfish   126 RAARALLSAVTHLLVLADMADVYQLLLQLKLVEENLMKVRNAGTEQDLGIQYKALKPEVDKLNMM 190

  Fly   168 TGHHRNSFKEERRRAQMFSARQILEKSIAILLTSSKNSLIHSDCVIVKENRDTVFCQIRRAMDLI 232
            ....:...|:...:.||.:||.:|::::.:|.|:|:..|.|.|....|.|||.::.|::.|:..|
Zfish   191 AAKRQQELKDVHHKDQMAAARGVLQRNVPMLYTASRACLQHPDVAAYKANRDLIYKQLQHAVSGI 255

  Fly   233 HFVVKDSIFDTAKHMPFEKQASNPNYENESIYTTIKRIVNLIKRYKYQMSYYEGSGEGNNNSDAY 297
                                 ||                               :.:..::.|:.
Zfish   256 ---------------------SN-------------------------------AAQATSSEDSS 268

  Fly   298 FSFLDDDLWKSEKNLPSAAGGGRMVNN-TNFRKHLSSESLDLREE-----LSLAFEKLFEKAHDF 356
            ||              ..||||.:... .||.|.:..:.|...||     |....|.:...|...
Zfish   269 FS--------------QTAGGGELAYALNNFDKQIIVDPLSFSEERFRPSLEERLESIISGAALM 319

  Fly   357 TDSPYISHNHRKNILSYCDNCKLEFDLYLNTIMKDQHEGGGGAGGVGGVGGGQVKGRSDPELG-- 419
            .||.....:.|:.|::.|::.:......|:..|       |.||.         |.:|| .|.  
Zfish   320 ADSSCTRDDRRERIVAECNSVRQALQDLLSEYM-------GNAGR---------KEKSD-ALNTA 367

  Fly   420 ---MLSSLEELCKQLVVSVSSQIED-FNESLKICSKLVKSFHVLATNYDIDNLNQRSSKFHDCCD 480
               |.....:|.:||..:|...:.| |.|:......|:::    |.|.:...:.:.:..|.:..:
Zfish   368 IDRMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEA----AKNGNEKEVKEYAQVFREHAN 428

  Fly   481 HIFDICKLLQHIAPTERLQVQAKCLAINLRIYGPQVFIAAKILWKYSNSSAANENFESFSDMW-- 543
            .:.::..|...|:..|......:..|..|....|||..||..|....||..|.:|.:.|.|.|  
Zfish   429 KLIEVANLACSISNNEEGVKLVRMAASQLETLCPQVINAALALAAKPNSKVAQDNMDLFKDQWEK 493

  Fly   544 --KWLT---NEISMIAKKILVSINTTKGD----------RDAD---------------------- 571
              :.||   ::|:.|...:.||.|....|          :|.|                      
Zfish   494 QVRVLTDAVDDITSIDDFLCVSENHILEDVNKCVIALQEKDVDGLDRTAGAIRGRAARVVHVVTS 558

  Fly   572 -----------------------------AEKCESSSDKLT-KSGVPATE----DGEMVEYSGL- 601
                                         .|:.|::.:.|: .:|.|..|    |...:.|.|: 
Zfish   559 EMDNYMPGVYTEKVLEATKLLTETVMPRFTEQVEAAVEALSANNGQPVDENEFIDASRLVYDGVR 623

  Fly   602 ------------EGKNNGDLNT------------------------------------------- 611
                        |..::.|..|                                           
Zfish   624 DIRKAVLMIRTPEELDDSDFETEDFDSRSRTSVQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQV 688

  Fly   612 --YQ----------SKWSEDLSDDNDILKRAKNMSAMAFLMYQFTKGNGSLRTTQDLFTQAEYFA 664
              :|          |||.:   ..|||:..||.|..:...|..||:|.|.|:.|.|:.:.|:..|
Zfish   689 ASFQEEKSKLDAEVSKWDD---SGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIA 750

  Fly   665 EEANRLYKVLRHFSYQVPASDNKKDLLNILDRVPTFVQALQFTVK----DHTVGKAATFVKVD-- 723
            |..:|:.|:.|..:.|.|.|..|:|||..|.|:..|...|....|    ...:|.......:|  
Zfish   751 EAGSRMDKLGRAIADQCPDSACKQDLLAYLQRIALFCHQLNICSKVKAEVQNLGGELVVSGLDSA 815

  Fly   724 -HVIRETKNLMNVINKVVSKCFECATKYK-------LNLTGIT 758
             .:|:..|||||.:...|...:..:|||:       ||:..|:
Zfish   816 MSLIQAAKNLMNSVVSTVKASYVASTKYQKSQDMQSLNMPAIS 858

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 183/870 (21%)
ctnna1NP_571531.1 Vinculin 82..867 CDD:279395 184/875 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.