DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and Vcl

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:XP_006251701.2 Gene:Vcl RGDID:1311217 Length:1134 Species:Rattus norvegicus

Alignment Length:1131 Identity:169/1132 (15%)
Similarity:320/1132 (28%) Gaps:467/1132 (41%)


  Fly    38 AVERFITIGEIIAEENID--IKGDMYEAAKEARDAGKSIERLCDISPLSGMELRHHIEPLKDYGA 100
            ||...:.:|:...:...|  :|.||..|..:..:|...:.:...:     ::...:..|.:||  
  Rat    50 AVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQM-----LQSDPYSVPARDY-- 107

  Fly   101 IILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASESLEKLESVMNFTEFVRAFSVFGTEMIELA 165
            :|..:|.:||..:.:||..|...|:|::...|...|.|...|.|....:.|......|..|.::|
  Rat   108 LIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMA 172

  Fly   166 YLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTSSKNSLIHSDCVIVKENRDTVFCQIRRAMD 230
            .:....:.....:..|..:.::...:::.:.:|:::.|                           
  Rat   173 KMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMK--------------------------- 210

  Fly   231 LIHFVVKDSIFDTAKHMPFEKQASNPNYENESIYTTIKRIVNLIKRYKYQMSYYEGSGEGNNNSD 295
             |....|:|     |:...|:...|.|:....:...|..|:.::     |::.::.....:.:::
  Rat   211 -IFVTTKNS-----KNQGIEEALKNRNFTVGKMSAEINEIIRVL-----QLTSWDEDAWASKDTE 264

  Fly   296 AY---FSFLDDDL-----WKSEKNL-PSAAG------------------GGR----MVNNTNFRK 329
            |.   .:.:|..|     |..:.|. |..||                  .|:    ::.......
  Rat   265 AMKRALASIDSKLNQAKGWLRDPNASPGDAGEQAIRQILDEAGKVGELCAGKERREILGTCKMLG 329

  Fly   330 HLSSESLDLR---------------------EELSLAFEKLFEKAHDFTDSPY-------ISHN- 365
            .::.:..|||                     :.|:...|....|....|:|..       .:.| 
  Rat   330 QMTDQVADLRARGQGASPVAMQKAQQVSQGLDVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNW 394

  Fly   366 -------------------HRKNILSYCDNCKLEFDLY--------LNTIMKDQHEGGGG----- 398
                               ..:.|...||:.|...|:.        |.:.:.|....|.|     
  Rat   395 LADPNGGPEGEEQIRGALAEARKIAELCDDPKERDDILRSLGEIAALTSKLGDLRRQGKGDSPEA 459

  Fly   399 ----------------------------------AGGV--------------GGVGGGQVKG--- 412
                                              .|.:              .|||...::|   
  Rat   460 RALAKQVATALQNLQTKTNRAVANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVA 524

  Fly   413 -------------RSDPELGMLSSLEELCKQL-------------VVSVSSQIEDFNESLKI--- 448
                         |.| .|.....:::|..||             ..:::||::|..:.||.   
  Rat   525 EGHRLANVMMGPYRQD-LLAKCDRVDQLAAQLADLAARGEGESPQARALASQLQDSLKDLKTQMQ 588

  Fly   449 -------------CSKLVKSFHVLAT-NYDIDN----LNQRSSKFHDCCDHIFDICKLLQHI--- 492
                         .:..:|...|.|| ..|..|    .::|::.|.:....:....:....:   
  Rat   589 EAMTQEVSDVFSDTTTPIKLLAVAATAPPDAPNREEVFDERAANFENHSGRLGATAEKAAAVGAA 653

  Fly   493 --APTERLQVQAKCLAINLRIYGPQVFIAAKILWKYSNSSAANENFESFSDMW------------ 543
              :..|.:|...|    ..|...|||..||:||.:...:.||.|:||:..:.|            
  Rat   654 NKSTVEGIQASVK----TARELTPQVISAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVD 714

  Fly   544 --------------------------------KWLTNEISMIAKK----ILVSINTTKGDRDAD- 571
                                            :.|....:.||::    :||:....:...|.. 
  Rat   715 EAIDTKSLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKREVENSEDPKF 779

  Fly   572 AEKCESSSDKLTK---------------------------SGV---------------------- 587
            .|..:::||:|:|                           ||.                      
  Rat   780 REAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEPDFPP 844

  Fly   588 ---------------------------------PATEDGEMVEYSGLEGKNN------GDLNTYQ 613
                                             |..:|.|..|....|..|.      ..|:...
  Rat   845 PPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMMAARQLHDEA 909

  Fly   614 SKWS-----------------------------EDLSDD-------------------------- 623
            .|||                             .|:.||                          
  Rat   910 RKWSSKPGLPAAQVGIGVVAEADAADAVGFPFPSDMEDDSEPELLLVPANQPVNQPILAAAQSLH 974

  Fly   624 ----------NDILKRAKNMSAMAFLMYQFTKGNGSLRTTQDLFTQAEYFAEEANRLYKVLRHFS 678
                      |||:..||.|:.:...|.:..:|...  |.:.|...|:..|:.::.:.::.:..:
  Rat   975 REATKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSG--TKRALIQCAKDIAKASDEVTRLAKEVA 1037

  Fly   679 YQVPASDNKKDLLNILDRVPTFVQALQF--TVKDHTVGKA---------ATFVKVDHVIRETKNL 732
            .|......:.:||.:.:|:||....|:.  |||...:|:.         ||    :.::...:||
  Rat  1038 KQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQAT----EMLVHNAQNL 1098

  Fly   733 MNVINKVVSKCFECATKYKLNLTGIT 758
            |..:.:.|.:....:.|.:.: .|.|
  Rat  1099 MQSVKETVREAEAASIKIRTD-AGFT 1123

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 164/1113 (15%)
VclXP_006251701.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.