DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and Ctnnal1

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_001100119.1 Gene:Ctnnal1 RGDID:1311434 Length:731 Species:Rattus norvegicus

Alignment Length:754 Identity:210/755 (28%)
Similarity:373/755 (49%) Gaps:100/755 (13%)


  Fly     7 STVNNQRFRVRDMDNEQIMSTFGNIGHLLNIAVERFITIGEIIAEENIDIKGDMYEAAKEARDAG 71
            :|:.|.:...:..|  :.:.....:|..:|:||.||:.:||.||.||.|:|.::..|..||:.||
  Rat    48 TTLINHKDNTKKSD--KTLQAIQRVGQAVNLAVGRFVKVGEAIANENWDLKEEISIACIEAKQAG 110

  Fly    72 KSIERLCDISPLSGMELRHHIEPLKDYGAIILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASE 136
            ::|..|.|::..:.:|....:..|.|...::.|||.||||||::|||.|.:|:|:::|::.:...
  Rat   111 ETIASLTDVTKWNHLESDGQVTILTDKTGVVQAARLLLSSVTKVLLLADQVVIKQIVTSRNKVLA 175

  Fly   137 SLEKLESVMNFTEFVRAFSVFGTEMIELAYLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTS 201
            ::|:||.|.:|.|||:.||.||.||:|.|||||..:|..|:|:::|:|..||.:|||...:|||:
  Rat   176 TMERLERVNSFQEFVQIFSQFGNEMVEFAYLTGDRQNDLKDEKKKARMAVARAVLEKGTMMLLTA 240

  Fly   202 SKNSLIHSDCVIVKENRDTVFCQIRRAMDLIHFVVKDSIFDTAKHMPFEKQASNPNYENESIYTT 266
            ||..|.|..|....:|::.||.::|.|::.:..:|.|.           :...:.:..:.||:|.
  Rat   241 SKTCLRHPSCESAHKNKEGVFDRMRAALEKVIEIVTDC-----------RLNRDTDSSSVSIFTG 294

  Fly   267 IKRIVNLIKRYKYQMSYYEGSGEGNNNSDAYFSFLDDDLWKSEKNLPSAAGGGRMVNNTNFRKHL 331
            ||.:                                                  .:|....|:::
  Rat   295 IKEL--------------------------------------------------KLNMEALRENV 309

  Fly   332 SSESLDLREELSLAFEKLFEKAHDFTDSPYISHNHRKNILSYCDNCKLEFDLYLNTIMKDQHEGG 396
            ..||   :|.||.|.|.:.|:..|||||.|.||.||:.||......:.|...:::..|:.|....
  Rat   310 YFES---KENLSAALEVILERVEDFTDSAYTSHEHRERILELSAQARTEVQQFISVWMQAQSRKT 371

  Fly   397 GGAGGVGGVGGGQVKGRSDPELGMLS---SLEELCKQL---VVSVSSQIEDFNESLKICSKLVKS 455
            ..|.             .:.||.:|.   ||:||.|:|   .:.:::.:..|:..    ..::|:
  Rat   372 KSAA-------------EELELTVLKVSHSLDELRKELHCTAMQLAADLLKFHAD----HVVLKA 419

  Fly   456 FHVLATNYDIDNLNQRSSKFHDCCDHIFDICKLLQHIAPTERLQVQAKCLAINLRIYGPQVFIAA 520
            ..|.....:::.|.:.:.|..:..:.:.:.|:||:|::.||.|::.........::.|.|:..||
  Rat   420 LKVTGVEGNLEALAEYACKLSEQKEQLVETCRLLRHVSGTEPLEITCMHAEETFQVTGQQIISAA 484

  Fly   521 KILWKYSNSSAANENFESFSDMWKWLTNEISMIAKKILVSINTTKGDR----DADAEKCESSSDK 581
            :.|..:.:|..|.||.:.|.:.|:...::::.:.::|.......:|::    ........:::.|
  Rat   485 ETLTLHPSSKIAKENLDVFCEAWESQISDLATLLREISDVFEGRRGEKYDHLSLPKPMKNNANLK 549

  Fly   582 LTKSGVPATEDGEMVEYSGLE-GKNNGDLNTYQSKWSEDLSDDNDILKRAKNMSAMAFLMYQFTK 645
            ..||..|.:|:...:...||: |..:.|.:....||.:   |||:|::..:|||.||:.:|.||:
  Rat   550 SVKSDKPDSEEQAKIAKLGLKLGLLSSDADCEIEKWED---DDNEIVRHGRNMSRMAYSLYLFTR 611

  Fly   646 GNGSLRTTQDLFTQAEYFAEEANRLYKVLRHFSYQVPASDNKKDLLNILDRVPTFVQALQFTVKD 710
            |.|.|:|:|||....|.||.|..:|...::.||.|:...|....||.|...:|...| ||...| 
  Rat   612 GEGPLKTSQDLIHFLEVFATEGLKLTSSIQSFSKQLKDDDKLMLLLEINKLIPLCHQ-LQTITK- 674

  Fly   711 HTVGKAATFVKVDHVIRETKNLMNVINKVVSKCFECATK 749
             |..::..|:|||..:.:.:::|.::.:::|.|::...|
  Rat   675 -TSLQSKVFLKVDKCVTKIRSMMTLVVQLLSLCYKLLKK 712

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 197/710 (28%)
Ctnnal1NP_001100119.1 Vinculin 91..674 CDD:279395 187/668 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80381399
eggNOG 1 0.900 E1_KOG3681
Hieranoid 1 1.000
Homologene 1 1.000 H2815
Inparanoid 1 1.050 291 1.000 Inparanoid score I2659
OMA 1 1.010
OrthoDB 1 1.010 D127258at33208
OrthoFinder 1 1.000 FOG0006446
OrthoInspector 1 1.000 T1085808
orthoMCL 1 0.900 OOG5_133957
Panther 1 1.100 LDO PTHR46342
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.