DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and Ctnna2

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:XP_017448033.1 Gene:Ctnna2 RGDID:1305060 Length:966 Species:Rattus norvegicus

Alignment Length:917 Identity:194/918 (21%)
Similarity:352/918 (38%) Gaps:256/918 (28%)


  Fly    33 HLLNIAVER----FITIGEIIAEENIDIKGDMYEAAKEARDAGKSI----ERLCDISPLSGMELR 89
            |:|..:||:    |:..||.||:|:.|:|.::..|.::.|..|:::    ....| .|.|.::  
  Rat    71 HVLAASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFAD-DPCSSVK-- 132

  Fly    90 HHIEPLKDYGAIILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASESLEKLESVMNFTEFVRAF 154
                    .|.::.|||:|||:|||:|:|.|:..|.:||:..|...|:||.:::..|..:....|
  Rat   133 --------RGTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRF 189

  Fly   155 SVFGTEMIELAYLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTSSKNSLIHSDCVIVKENRD 219
            ..||.||::|.|:....:...|:...|.:|.:||..|:|:..:|.|:|:..|.|.|....:.|||
  Rat   190 KEFGKEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANRD 254

  Fly   220 TVFCQIRRAMDLIHFVVKDSIFDTAKHMPFEKQASNPNYENESIYTTIKRIVNLIKRYKYQ---- 280
            .||.|::.|:..|....               ||::|..|.:. :|.|..:...:..:..:    
  Rat   255 YVFKQVQEAIAGISSAA---------------QATSPTDEAKG-HTGIGELAAALNEFDNKIILD 303

  Fly   281 -MSYYEGSGEGNNNSDAYFSFLDDDLWKSEKNLPSAAGGGRMVNNTNF-----RKHLSSESLDLR 339
             |::          |:|.|.      ...|:.|.|...|..::.:::.     |:.:.:|...:|
  Rat   304 PMTF----------SEARFR------PSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVR 352

  Fly   340 --------------------EELSLAFEKLFEKAHDFTDSPYISHNHRKNILSYCDNCKLEFDLY 384
                                :.|::|.:|:.:|..|      :....||.::.:..:..||.::.
  Rat   353 QALQDLLSEYMNNTGRKEKGDPLNIAIDKMTKKTRD------LRRQLRKAVMDHISDSFLETNVP 411

  Fly   385 LNTIMKDQHEGGGGAGGVGGVGGGQVK---------------------GRSDPELGM------LS 422
            |..:::....|          ...:||                     ..|:.|.|:      .:
  Rat   412 LLVLIEAAKSG----------NEKEVKEYAQVFREHANKLVEVANLACSISNNEEGVKLVRMAAT 466

  Fly   423 SLEELCKQLV------------------------------------VSVSSQIEDF-----NESL 446
            .::.||.|::                                    |...:.::||     |..|
  Rat   467 QIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHIL 531

  Fly   447 KICSKLVKSFHVLATNYDIDNLNQRSSKFHD--------------------CCDHIFDICKLL-Q 490
            :..:|.|    :.....|:|.|::.:.....                    ..:.:.:..||| :
  Rat   532 EDVNKCV----IALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSE 592

  Fly   491 HIAP--TERLQVQAKCLAINLRIYGPQVFIAAKILWKYSNSSAANENFESFSDMWKWLTNEISMI 553
            .:.|  .|:::|..:.|:.|:    ||.|               .||  .|.|..:.:.:.:..|
  Rat   593 TVMPRFAEQVEVAIEALSANV----PQPF---------------EEN--EFIDASRLVYDGVRDI 636

  Fly   554 AKKILVSINTTKGDRDADAEK----------CESSSDKL--------TKSGVPATEDGEMVEYSG 600
            .|.:|:.....:.:.|:|.|:          .::..|:|        ..:.:|..|..::.|...
  Rat   637 RKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVE 701

  Fly   601 LEGKNNGDLNTYQSKWSEDLSDDNDILKRAKNMSAMAFLMYQFTKGNGSLRTTQDLFTQAEYFAE 665
            :..:....|:...:||.:   ..|||:..||.|..:...|..||:|.|.|:.|.|:...|:..||
  Rat   702 IFHQEKSKLDAEVAKWDD---SGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAE 763

  Fly   666 EANRLYKVLRHFSYQVPASDNKKDLLNILDRVPTFVQALQFTVKDHTVGKAATFVKVDHVIRETK 730
            ..:|:.|:.|..:.|.|.|..|:|||..|.|:..:...|....|               |..|.:
  Rat   764 AGSRMDKLARAVADQCPDSACKQDLLAYLQRIALYCHQLNICSK---------------VKAEVQ 813

  Fly   731 NL---MNVINKVVSKCFECATKYKLNLTGITGGLTSERSNE--NMAGGMCDSKGTTSSSDIPXHY 790
            ||   :.|....|...|  .|.|:::...|.||..|:.|..  ..|.|.....|::.||.:....
  Rat   814 NLGGELIVSGTGVQSTF--TTFYEVDCDVIDGGRASQLSTHLPTCAEGAPIGSGSSDSSMLDSAT 876

  Fly   791 GMARRAK 797
            .:.:.||
  Rat   877 SLIQAAK 883

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 173/849 (20%)
Ctnna2XP_017448033.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.