DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and CTNNA3

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:XP_016871641.1 Gene:CTNNA3 HGNCID:2511 Length:970 Species:Homo sapiens

Alignment Length:892 Identity:181/893 (20%)
Similarity:320/893 (36%) Gaps:258/893 (29%)


  Fly    46 GEIIAEENIDIKGDMYEAAKEARDAGK----SIERLCDISPLSGMELRHHIEP--LKDYGAIILA 104
            ||.||:|...:|.::..:.:|.|...:    |.||..|             :|  |....|::.|
Human    85 GEKIAQEATVLKDELTASLEEVRKESEALKVSAERFTD-------------DPCFLPKREAVVQA 136

  Fly   105 ARSLLSSVTRILLLVDIIVVKKLLTAKKRASESLEKLESVMNFTEFVRAFSVFGTEMIELAYLTG 169
            ||:||::|||:|:|.|:|.|..||........:.|.|::|.|.::..:.:...|.|:..|.||..
Human   137 ARALLAAVTRLLILADMIDVMCLLQHVSAFQRTFESLKNVANKSDLQKTYQKLGKELENLDYLAF 201

  Fly   170 HHR-----------------------NSFKEERRRAQMFSARQILEKSIAILLTSSKNSLIHSDC 211
            ..:                       :..|...:|.::..||..|:::..:|.:.....|.|||.
Human   202 KRQQVNNSGLNTTFAFSRKNLPTPKASDLKSPNQRDEIAGARASLKENSPLLHSICSACLEHSDV 266

  Fly   212 VIVKENRDTVFCQIRRAMDLIHFVVKDSIFDTAKHMPFEKQASNPNYENESIYTTIKRIVNLIKR 276
            ..:|.::|||..:|:.|:::|          :......:...:.|..:..::.:.:..:.|||..
Human   267 ASLKASKDTVCEEIQNALNVI----------SNASQGIQNMTTPPEPQAATLGSALDELENLIVL 321

  Fly   277 YKYQMSYYEGSGEGNNNSDAYFSFLDDDLWKS-EKNLPSAAGGGRMVNNTNFRKHLSSESLDLRE 340
            ....::                   ::::..| ||.|.:...|..::.:       ||.:.||..
Human   322 NPLTVT-------------------EEEIRPSLEKRLEAIISGAALLAD-------SSCTRDLHR 360

  Fly   341 ELSLAFEKLFEKAHDFTDSPYISHNHRKNILSYCDNCKLEF---DLYL--------NTIMKDQHE 394
            |..:|......:|.....|.|: :|.||  |..|...:|..   .:||        :||....||
Human   361 ERIIAECNAIRQALQDLLSEYM-NNMRK--LIPCRATRLTKTAPQVYLTSGLVDSKSTISLLHHE 422

  Fly   395 GGGGAGGVGGVGGGQVKGRSDPELGMLSSLEELCK-------QLVVSVSSQIED-FNESLKICSK 451
            ...|.           |.||:.   :..:|:.:||       ||..::...:.| |.::......
Human   423 IKAGK-----------KERSNT---LNIALDNMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLV 473

  Fly   452 LVKSFHVLATNYDIDNLNQRSSKFHDCCDHIFDICKLLQHIAPTERLQVQAKCLAINLRIYGPQV 516
            |:::    |.|.....:.:.::.||:....:.::..|...::..|......|..|.:|....||:
Human   474 LIEA----AKNGREKEIKEYAAIFHEHTSRLVEVANLACSMSTNEDGIKIVKIAANHLETLCPQI 534

  Fly   517 FIAAKILWKYSNSSAANENFESFSDMWK----WLT---NEISMIAKKILVSINTTKGD------- 567
            ..||..|.....|.|.....|.:...|:    .||   ::|:.|...:.||.:....|       
Human   535 INAALALAARPKSQAVKNTMEMYKRTWENHIHVLTEAVDDITSIDDFLAVSESHILEDVNKCIIA 599

  Fly   568 -RDADAEKCESSS---------------------------------------------------- 579
             ||.||:..:.::                                                    
Human   600 LRDQDADNLDRAAGAIRGRAARVAHIVTGEMDSYEPGAYTEGVMRNVNFLTSTVIPEFVTQVNVA 664

  Fly   580 -DKLTKSGVPATEDGEMVEYS-----------------------------------------GLE 602
             :.|:||.:...:|.:.|:.|                                         ..|
Human   665 LEALSKSSLNVLDDNQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEEEHEVRSHTSIQTE 729

  Fly   603 GKNN-------------------GDLNTYQSKWSEDLS--DD--NDILKRAKNMSAMAFLMYQFT 644
            ||.:                   .|....:||...::.  ||  |||:..||||..:...|..||
Human   730 GKTDRAKMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKNMCMIMMEMTDFT 794

  Fly   645 KGNGSLRTTQDLFTQAEYFAEEANRLYKVLRHFSYQVPASDNKKDLLNILDRVPTFVQAL----Q 705
            :|.|.|:.|.|:...|:..:|..:|:..:.|..:.|.|....|:|||..|:::..:...|    |
Human   795 RGKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLEQIKFYSHQLKICSQ 859

  Fly   706 FTVKDHTVGKAATFVKVDHV---IRETKNLMNVINKVVSKCFECATK 749
            ...:...:|.......:|.|   |:..|||||.:.:.|...:..:||
Human   860 VKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTK 906

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 177/887 (20%)
CTNNA3XP_016871641.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.